SCOPe 2.08: Domain d4rcga1: 4rcg A:8-244

Lineage for d4rcga1 (4rcg A:8-244)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
   contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain

4. Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families)

5. Family c.109.1.0: automated matches [227144] (1 protein)
   not a true family

6. Protein automated matches [226847] (5 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [271217] (3 PDB entries)

8. Domain d4rcga1: 4rcg A:8-244 [271222]
   Other proteins in same PDB: d4rcga2
   automated match to d4wiua1
   complexed with gdp, mg, peg

Details for d4rcga1

PDB Entry: 4rcg, 2.6 Å

PDB Description: crystal structure analysis of mtb pepck without mn+2

PDB Compounds: (A:) Phosphoenolpyruvate carboxykinase [GTP]

SCOPe Domain Sequences for d4rcga1:

Sequence; same for both SEQRES and ATOM records:

>d4rcga1 c.109.1.0 (A:8-244) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
gldtaptnhqgllswveevaeltqpdrvvftdgseeefqrlcdqlveagtfirlnpekhk
nsylalsdpsdvarvesrtyicsakeidagptnnwmdpgemrsimkdlyrgcmrgrtmyv
vpfcmgplgaedpklgveitdseyvvvsmrtmtrmgkaalekmgddgffvkalhsvgapl
epgqkdvawpcsetkyithfpetreiwsygsgyggnallgkkcyslriasamahdeg

Timeline for d4rcga1:

• d4rcga1 first appeared in SCOPe 2.05
  
• d4rcga1 appears in SCOPe 2.07