Lineage for d4rcga2 (4rcg A:245-606)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143071Fold c.91: PEP carboxykinase-like [53794] (1 superfamily)
    contains a P-loop NTP-binding motif; mixed beta-sheet folds into a barrel-like structure with helices packed on one side
  4. 2143072Superfamily c.91.1: PEP carboxykinase-like [53795] (3 families) (S)
  5. 2143188Family c.91.1.0: automated matches [196141] (1 protein)
    not a true family
  6. 2143189Protein automated matches [196142] (6 species)
    not a true protein
  7. 2143222Species Mycobacterium tuberculosis [TaxId:83332] [271220] (3 PDB entries)
  8. 2143225Domain d4rcga2: 4rcg A:245-606 [271223]
    Other proteins in same PDB: d4rcga1
    automated match to d4wiua2
    complexed with gdp, mg, peg

Details for d4rcga2

PDB Entry: 4rcg (more details), 2.6 Å

PDB Description: crystal structure analysis of mtb pepck without mn+2
PDB Compounds: (A:) Phosphoenolpyruvate carboxykinase [GTP]

SCOPe Domain Sequences for d4rcga2:

Sequence, based on SEQRES records: (download)

>d4rcga2 c.91.1.0 (A:245-606) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
wlaehmlilklispenkayyfaaafpsacgktnlamlqptipgwraetlgddiawmrfgk
dgrlyavnpefgffgvapgtnwksnpnamrtiaagntvftnvaltddgdvwweglegdpq
hlidwkgndwyfretetnaahpnsryctpmsqcpilapewddpqgvpisgilfggrrktt
vplvteardwqhgvfigatlgseqtaaaegkvsnvrrdpmamlpflgynvgdyfqhwinl
gkhadeaklpkvffvnwfrrgddgrflwpgfgensrvlkwivdriehkaggattpigtvp
avedldldgldvdaadvaaalavdadewrqelplieewlqfvgeklptgvkdefdalker
lg

Sequence, based on observed residues (ATOM records): (download)

>d4rcga2 c.91.1.0 (A:245-606) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
wlaehmlilklispenkayyfaaafpsacgktnlamlqptipgwraetlgddiawmrfgk
dgrlyavnpefgffgvapgtnwksnpnamrtiaagntvftnvaltddgdvwweglegdpq
hlidwkgndwyfretetnaahpnsryctpmsqcpilapewddpqgvpisgilfggrrktt
vplvteardwqhgvfigatlgseqtanvrrdpmamlpflgynvgdyfqhwinlgkhadea
klpkvffvnwfrrgddgrflwpgfgensrvlkwivdriehkaggattpigtvpavedldl
dgldvdaadvaaalavdadewrqelplieewlqfvgeklptgvkdefdalkerlg

SCOPe Domain Coordinates for d4rcga2:

Click to download the PDB-style file with coordinates for d4rcga2.
(The format of our PDB-style files is described here.)

Timeline for d4rcga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4rcga1