![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily) contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain |
![]() | Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) ![]() |
![]() | Family c.109.1.0: automated matches [227144] (1 protein) not a true family |
![]() | Protein automated matches [226847] (5 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:83332] [271217] (3 PDB entries) |
![]() | Domain d4rcga1: 4rcg A:8-244 [271222] Other proteins in same PDB: d4rcga2 automated match to d4wiua1 complexed with gdp, mg, peg |
PDB Entry: 4rcg (more details), 2.6 Å
SCOPe Domain Sequences for d4rcga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rcga1 c.109.1.0 (A:8-244) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} gldtaptnhqgllswveevaeltqpdrvvftdgseeefqrlcdqlveagtfirlnpekhk nsylalsdpsdvarvesrtyicsakeidagptnnwmdpgemrsimkdlyrgcmrgrtmyv vpfcmgplgaedpklgveitdseyvvvsmrtmtrmgkaalekmgddgffvkalhsvgapl epgqkdvawpcsetkyithfpetreiwsygsgyggnallgkkcyslriasamahdeg
Timeline for d4rcga1: