Lineage for d1e02a_ (1e02 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2804248Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 2804668Protein Odorant-binding protein [50821] (2 species)
    C-termini swapping dimer
  7. 2804686Species Pig (Sus scrofa) [TaxId:9823] [50823] (9 PDB entries)
  8. 2804695Domain d1e02a_: 1e02 A: [27108]
    complexed with una

Details for d1e02a_

PDB Entry: 1e02 (more details), 2.15 Å

PDB Description: porcine odorant binding protein complexed with undecanal
PDB Compounds: (A:) odorant-binding protein

SCOPe Domain Sequences for d1e02a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e02a_ b.60.1.1 (A:) Odorant-binding protein {Pig (Sus scrofa) [TaxId: 9823]}
pfelsgkwitsyigssdlekigenapfqvfmrsiefddkeskvylnffskengiceefsl
igtkqegntydvnyagnnkfvvsyasetaliisninvdeegdktimtgllgkgtdiedqd
lekfkevtrengipeenivniierddcpa

SCOPe Domain Coordinates for d1e02a_:

Click to download the PDB-style file with coordinates for d1e02a_.
(The format of our PDB-style files is described here.)

Timeline for d1e02a_: