PDB entry 1e02

View 1e02 on RCSB PDB site
Description: porcine odorant binding protein complexed with undecanal
Class: odorant binding protein
Keywords: odorant binding protein, lipocalins
Deposited on 2000-03-09, released 2000-12-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.192
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: odorant-binding protein
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e02a_
  • Chain 'B':
    Compound: odorant-binding protein
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1e02b_
  • Heterogens: UNA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1e02A (A:)
    qepqpeqdpfelsgkwitsyigssdlekigenapfqvfmrsiefddkeskvylnffsken
    giceefsligtkqegntydvnyagnnkfvvsyasetaliisninvdeegdktimtgllgk
    gtdiedqdlekfkevtrengipeenivniierddcpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e02A (A:)
    pfelsgkwitsyigssdlekigenapfqvfmrsiefddkeskvylnffskengiceefsl
    igtkqegntydvnyagnnkfvvsyasetaliisninvdeegdktimtgllgkgtdiedqd
    lekfkevtrengipeenivniierddcpa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1e02B (B:)
    qepqpeqdpfelsgkwitsyigssdlekigenapfqvfmrsiefddkeskvylnffsken
    giceefsligtkqegntydvnyagnnkfvvsyasetaliisninvdeegdktimtgllgk
    gtdiedqdlekfkevtrengipeenivniierddcpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1e02B (B:)
    elsgkwitsyigssdlekigenapfqvfmrsiefddkeskvylnffskengiceefslig
    tkqegntydvnyagnnkfvvsyasetaliisninvdeegdktimtgllgkgtdiedqdle
    kfkevtrengipeenivniierddcpa