SCOPe 2.08: Domain d1dzjb_: 1dzj B:

Lineage for d1dzjb_ (1dzj B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Odorant-binding protein [50821] (2 species)
   C-termini swapping dimer

7. Species Pig (Sus scrofa) [TaxId:9823] [50823] (9 PDB entries)

8. Domain d1dzjb_: 1dzj B: [27103]
   complexed with ses

Details for d1dzjb_

PDB Entry: 1dzj, 2 Å

PDB Description: porcine odorant binding protein complexed with 2-amino-4-butyl-5- propylselenazole

PDB Compounds: (B:) odorant-binding protein

SCOPe Domain Sequences for d1dzjb_:

Sequence; same for both SEQRES and ATOM records:

>d1dzjb_ b.60.1.1 (B:) Odorant-binding protein {Pig (Sus scrofa) [TaxId: 9823]}
felsgkwitsyigssdlekigenapfqvfmrsiefddkeskvylnffskengiceefsli
gtkqegntydvnyagnnkfvvsyasetaliisninvdeegdktimtgllgkgtdiedqdl
ekfkevtrengipeenivniierddcpa

Timeline for d1dzjb_:

• d1dzjb_ first appeared (with stable ids) in SCOP 1.55
  
• d1dzjb_ appears in SCOPe 2.07