PDB entry 1dzj

View 1dzj on RCSB PDB site
Description: porcine odorant binding protein complexed with 2-amino-4-butyl-5-propylselenazole
Class: transport
Keywords: lipocalin, transport, olfaction, sensory transduction
Deposited on 2000-03-01, released 2000-12-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-06-02.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.229
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: odorant-binding protein
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dzja_
  • Chain 'B':
    Compound: odorant-binding protein
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dzjb_
  • Heterogens: SES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dzjA (A:)
    qepqpeqdpfelsgkwitsyigssdlekigenapfqvfmrsiefddkeskvylnffsken
    giceefsligtkqegntydvnyagnnkfvvsyasetaliisninvdeegdktimtgllgk
    gtdiedqdlekfkevtrengipeenivniierddcpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dzjA (A:)
    felsgkwitsyigssdlekigenapfqvfmrsiefddkeskvylnffskengiceefsli
    gtkqegntydvnyagnnkfvvsyasetaliisninvdeegdktimtgllgkgtdiedqdl
    ekfkevtrengipeenivniierddcpa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dzjB (B:)
    qepqpeqdpfelsgkwitsyigssdlekigenapfqvfmrsiefddkeskvylnffsken
    giceefsligtkqegntydvnyagnnkfvvsyasetaliisninvdeegdktimtgllgk
    gtdiedqdlekfkevtrengipeenivniierddcpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dzjB (B:)
    felsgkwitsyigssdlekigenapfqvfmrsiefddkeskvylnffskengiceefsli
    gtkqegntydvnyagnnkfvvsyasetaliisninvdeegdktimtgllgkgtdiedqdl
    ekfkevtrengipeenivniierddcpa