![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
![]() | Superfamily b.60.1: Lipocalins [50814] (10 families) ![]() bind hydrophobic ligands in their interior |
![]() | Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins) barrel, closed; n=8, S=12, meander |
![]() | Protein Odorant-binding protein [50821] (2 species) C-termini swapping dimer |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [50823] (9 PDB entries) |
![]() | Domain d1dzkb_: 1dzk B: [27097] complexed with prz |
PDB Entry: 1dzk (more details), 1.48 Å
SCOPe Domain Sequences for d1dzkb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dzkb_ b.60.1.1 (B:) Odorant-binding protein {Pig (Sus scrofa) [TaxId: 9823]} felsgkwitsyigssdlekigenapfqvfmrsiefddkeskvylnffskengiceefsli gtkqegntydvnyagnnkfvvsyasetaliisninvdeegdktimtgllgkgtdiedqdl ekfkevtrengipeenivniierddcpa
Timeline for d1dzkb_: