Lineage for d1dzka_ (1dzk A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. Protein Odorant-binding protein [50821] (2 species)
    C-termini swapping dimer
  7. Species Pig (Sus scrofa) [TaxId:9823] [50823] (9 PDB entries)
  8. Domain d1dzka_: 1dzk A: [27096]
    complexed with prz

Details for d1dzka_

PDB Entry: 1dzk (more details), 1.48 Å

PDB Description: porcine odorant binding protein complexed with pyrazine (2-isobutyl-3-metoxypyrazine)
PDB Compounds: (A:) odorant-binding protein

SCOPe Domain Sequences for d1dzka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dzka_ b.60.1.1 (A:) Odorant-binding protein {Pig (Sus scrofa) [TaxId: 9823]}
felsgkwitsyigssdlekigenapfqvfmrsiefddkeskvylnffskengiceefsli
gtkqegntydvnyagnnkfvvsyasetaliisninvdeegdktimtgllgkgtdiedqdl
ekfkevtrengipeenivniierddcpa

SCOPe Domain Coordinates for d1dzka_ are not available.

Timeline for d1dzka_:

Domains from other chains:
(mouse over for more information)
d1dzkb_