Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds) |
Fold e.19: HydA/Nqo6-like [56769] (1 superfamily) 2 domains: (1) alpa/beta; (2) Fe-S cluster-bound |
Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) |
Family e.19.1.1: Nickel-iron hydrogenase, small subunit [56771] (2 proteins) |
Protein automated matches [190110] (7 species) not a true protein |
Species Desulfovibrio fructosivorans [TaxId:596151] [270655] (4 PDB entries) |
Domain d4uewb_: 4uew B: [270701] Other proteins in same PDB: d4uewq_, d4uewr_, d4uews_ automated match to d4urhc_ complexed with f3s, fco, gol, mg, ni, sf4 |
PDB Entry: 4uew (more details), 2.08 Å
SCOPe Domain Sequences for d4uewb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uewb_ e.19.1.1 (B:) automated matches {Desulfovibrio fructosivorans [TaxId: 596151]} akhrpsvvwlhnaectgcteaairtikpyidalildtisldyqetimaaageaaeaalhq alegkdgyylvvegglptidggqwgmvaghpmiettkkaaakakgiicigtcsayggvqk akpnpsqakgvsealgvktinipgcppnpinfvgavvhvltkgipdldengrpklfygel vhdncprlphfeasefapsfdseeakkgfclyelgckgpvtynncpkvlfnqvnwpvqag hpclgcsepdfwdtmtpfyeqg
Timeline for d4uewb_: