SCOPe 2.07: Domain d4uewb_: 4uew B:

Lineage for d4uewb_ (4uew B:)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
   2 domains: (1) alpa/beta; (2) Fe-S cluster-bound

4. Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families)

5. Family e.19.1.1: Nickel-iron hydrogenase, small subunit [56771] (2 proteins)

6. Protein automated matches [190110] (7 species)
   not a true protein

7. Species Desulfovibrio fructosivorans [TaxId:596151] [270655] (4 PDB entries)

8. Domain d4uewb_: 4uew B: [270701]
   Other proteins in same PDB: d4uewq_, d4uewr_, d4uews_
   automated match to d4urhc_
   complexed with f3s, fco, gol, mg, ni, sf4

Details for d4uewb_

PDB Entry: 4uew, 2.08 Å

PDB Description: structure of h2-treated anaerobically purified d. fructosovorans nife- hydrogenase

PDB Compounds: (B:) Periplasmic [NiFe] hydrogenase Small subunit

SCOPe Domain Sequences for d4uewb_:

Sequence; same for both SEQRES and ATOM records:

>d4uewb_ e.19.1.1 (B:) automated matches {Desulfovibrio fructosivorans [TaxId: 596151]}
akhrpsvvwlhnaectgcteaairtikpyidalildtisldyqetimaaageaaeaalhq
alegkdgyylvvegglptidggqwgmvaghpmiettkkaaakakgiicigtcsayggvqk
akpnpsqakgvsealgvktinipgcppnpinfvgavvhvltkgipdldengrpklfygel
vhdncprlphfeasefapsfdseeakkgfclyelgckgpvtynncpkvlfnqvnwpvqag
hpclgcsepdfwdtmtpfyeqg

Timeline for d4uewb_:

• d4uewb_ first appeared in SCOPe 2.05
  
• d4uewb_ appears in SCOPe 2.06
  
• d4uewb_ appears in the current release, SCOPe 2.08