Lineage for d4uewa_ (4uew A:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2249152Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 2249153Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) (S)
  5. 2249154Family e.19.1.1: Nickel-iron hydrogenase, small subunit [56771] (2 proteins)
  6. 2249184Protein automated matches [190110] (7 species)
    not a true protein
  7. 2249198Species Desulfovibrio fructosivorans [TaxId:596151] [270655] (4 PDB entries)
  8. 2249205Domain d4uewa_: 4uew A: [270700]
    Other proteins in same PDB: d4uewq_, d4uewr_, d4uews_
    automated match to d4urhc_
    complexed with f3s, fco, gol, mg, ni, sf4

Details for d4uewa_

PDB Entry: 4uew (more details), 2.08 Å

PDB Description: structure of h2-treated anaerobically purified d. fructosovorans nife- hydrogenase
PDB Compounds: (A:) Periplasmic [NiFe] hydrogenase Small subunit

SCOPe Domain Sequences for d4uewa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uewa_ e.19.1.1 (A:) automated matches {Desulfovibrio fructosivorans [TaxId: 596151]}
akhrpsvvwlhnaectgcteaairtikpyidalildtisldyqetimaaageaaeaalhq
alegkdgyylvvegglptidggqwgmvaghpmiettkkaaakakgiicigtcsayggvqk
akpnpsqakgvsealgvktinipgcppnpinfvgavvhvltkgipdldengrpklfygel
vhdncprlphfeasefapsfdseeakkgfclyelgckgpvtynncpkvlfnqvnwpvqag
hpclgcsepdfwdtmtpfyeqg

SCOPe Domain Coordinates for d4uewa_:

Click to download the PDB-style file with coordinates for d4uewa_.
(The format of our PDB-style files is described here.)

Timeline for d4uewa_: