Lineage for d1a5uh1 (1a5u H:4916-5017)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 16389Fold b.58: Pyruvate kinase beta-barrel domain [50799] (1 superfamily)
  4. 16390Superfamily b.58.1: Pyruvate kinase beta-barrel domain [50800] (1 family) (S)
  5. 16391Family b.58.1.1: Pyruvate kinase beta-barrel domain [50801] (1 protein)
  6. 16392Protein Pyruvate kinase [50802] (5 species)
  7. 16422Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [50803] (4 PDB entries)
  8. 16438Domain d1a5uh1: 1a5u H:4916-5017 [27041]
    Other proteins in same PDB: d1a5ua2, d1a5ua3, d1a5ub2, d1a5ub3, d1a5uc2, d1a5uc3, d1a5ud2, d1a5ud3, d1a5ue2, d1a5ue3, d1a5uf2, d1a5uf3, d1a5ug2, d1a5ug3, d1a5uh2, d1a5uh3

Details for d1a5uh1

PDB Entry: 1a5u (more details), 2.35 Å

PDB Description: pyruvate kinase complex with bis mg-atp-na-oxalate

SCOP Domain Sequences for d1a5uh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a5uh1 b.58.1.1 (H:4916-5017) Pyruvate kinase {Rabbit (Oryctolagus cuniculus)}
peirtglikgsgtaevelkkgatlkitldnaymekcdenilwldyknickvvdvgskvyv
ddglislqvkqkgpdflvtevenggflgskkgvnlpgaavdl

SCOP Domain Coordinates for d1a5uh1:

Click to download the PDB-style file with coordinates for d1a5uh1.
(The format of our PDB-style files is described here.)

Timeline for d1a5uh1: