Lineage for d1ytfc_ (1ytf C:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 232263Fold b.56: Transcription factor IIA (TFIIA), N-terminal domain [50783] (1 superfamily)
    barrel, closed; n=6, S=12; mixed beta-sheet
  4. 232264Superfamily b.56.1: Transcription factor IIA (TFIIA), N-terminal domain [50784] (1 family) (S)
    dimer of non-identical beta-sheet subunits
  5. 232265Family b.56.1.1: Transcription factor IIA (TFIIA), N-terminal domain [50785] (1 protein)
  6. 232266Protein Transcription factor IIA (TFIIA), N-terminal domain [50786] (1 species)
  7. 232267Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50787] (1 PDB entry)
  8. 232268Domain d1ytfc_: 1ytf C: [27010]
    Other proteins in same PDB: d1ytfa1, d1ytfa2, d1ytfb_, d1ytfd1
    protein/DNA complex

Details for d1ytfc_

PDB Entry: 1ytf (more details), 2.5 Å

PDB Description: yeast tfiia/tbp/dna complex

SCOP Domain Sequences for d1ytfc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ytfc_ b.56.1.1 (C:) Transcription factor IIA (TFIIA), N-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
enlmlclydkvtrtkarwkcslkdgvvtinrndytfqkaqveaewv

SCOP Domain Coordinates for d1ytfc_:

Click to download the PDB-style file with coordinates for d1ytfc_.
(The format of our PDB-style files is described here.)

Timeline for d1ytfc_: