SCOPe 2.08: Domain d1ytfc_: 1ytf C:

Lineage for d1ytfc_ (1ytf C:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.56: Transcription factor IIA (TFIIA), beta-barrel domain [50783] (1 superfamily)
   barrel, closed; n=6, S=12; mixed beta-sheet

4. Superfamily b.56.1: Transcription factor IIA (TFIIA), beta-barrel domain [50784] (1 family)
   dimer of non-identical beta-sheet domains

5. Family b.56.1.1: Transcription factor IIA (TFIIA), beta-barrel domain [50785] (2 proteins)
   heterodimer of two homologous chains

6. Protein Large chain TOA1, C-terminal domain [88684] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88685] (2 PDB entries)

8. Domain d1ytfc_: 1ytf C: [27010]
   Other proteins in same PDB: d1ytfa1, d1ytfa2, d1ytfb_, d1ytfd1, d1ytfd2
   protein/DNA complex

Details for d1ytfc_

PDB Entry: 1ytf, 2.5 Å

PDB Description: yeast tfiia/tbp/dna complex

PDB Compounds: (C:) protein (transcription factor iia - toa1c subunit)

SCOPe Domain Sequences for d1ytfc_:

Sequence; same for both SEQRES and ATOM records:

>d1ytfc_ b.56.1.1 (C:) Large chain TOA1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
enlmlclydkvtrtkarwkcslkdgvvtinrndytfqkaqveaewv

Timeline for d1ytfc_:

• d1ytfc_ first appeared (with stable ids) in SCOP 1.55, called d1ytfc1
  
• d1ytfc_ appears in SCOPe 2.07