![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
![]() | Superfamily b.55.1: PH domain-like [50729] (14 families) ![]() |
![]() | Family b.55.1.5: Third domain of FERM [50776] (8 proteins) |
![]() | Protein Radixin [50779] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [50780] (9 PDB entries) |
![]() | Domain d1gc7a2: 1gc7 A:199-297 [27005] Other proteins in same PDB: d1gc7a1, d1gc7a3 |
PDB Entry: 1gc7 (more details), 2.8 Å
SCOPe Domain Sequences for d1gc7a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gc7a2 b.55.1.5 (A:199-297) Radixin {Mouse (Mus musculus) [TaxId: 10090]} emygvnyfeiknkkgtelwlgvdalglniyehddkltpkigfpwseirnisfndkkfvik pidkkapdfvfyaprlrinkrilalcmgnhelymrrrkp
Timeline for d1gc7a2: