Lineage for d1gc7a1 (1gc7 A:88-198)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697426Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
    core: 3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2697469Superfamily a.11.2: Second domain of FERM [47031] (2 families) (S)
    automatically mapped to Pfam PF00373
  5. 2697470Family a.11.2.1: Second domain of FERM [47032] (9 proteins)
  6. 2697500Protein Radixin [47035] (1 species)
  7. 2697501Species Mouse (Mus musculus) [TaxId:10090] [47036] (9 PDB entries)
  8. 2697508Domain d1gc7a1: 1gc7 A:88-198 [16370]
    Other proteins in same PDB: d1gc7a2, d1gc7a3

Details for d1gc7a1

PDB Entry: 1gc7 (more details), 2.8 Å

PDB Description: crystal structure of the radixin ferm domain
PDB Compounds: (A:) Radixin

SCOPe Domain Sequences for d1gc7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gc7a1 a.11.2.1 (A:88-198) Radixin {Mouse (Mus musculus) [TaxId: 10090]}
dvseeliqeitqrlfflqvkeailndeiycppetavllasyavqakygdynkeihkpgyl
andrllpqrvleqhkltkeqweeriqnwheehrgmlredsmmeylkiaqdl

SCOPe Domain Coordinates for d1gc7a1:

Click to download the PDB-style file with coordinates for d1gc7a1.
(The format of our PDB-style files is described here.)

Timeline for d1gc7a1: