SCOPe 2.07: Domain d4wjyb_: 4wjy B:

Lineage for d4wjyb_ (4wjy B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold

4. Superfamily a.138.1: Multiheme cytochromes [48695] (4 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins)
   the main characteristic feature of this motif is the packing of its two hemes
   many members contains one or more complete motifs flanked by incomplete motifs and/or other domains

6. Protein automated matches [190276] (12 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [269982] (1 PDB entry)

8. Domain d4wjyb_: 4wjy B: [269984]
   automated match to d1gu6a_
   complexed with ca, edo, hem

Details for d4wjyb_

PDB Entry: 4wjy, 2.15 Å

PDB Description: esherichia coli nitrite reductase nrfa h264n

PDB Compounds: (B:) Cytochrome c-552

SCOPe Domain Sequences for d4wjyb_:

Sequence; same for both SEQRES and ATOM records:

>d4wjyb_ a.138.1.3 (B:) automated matches {Escherichia coli [TaxId: 83333]}
tveaknetfapqhpdqylswkatseqservdalaedprlvilwagypfsrdynkprghaf
avtdvretlrtgapknaedgplpmacwsckspdvarliqkdgedgyfhgkwarggpeivn
nlgcadchntaspefakgkpeltlsrpyaarameaigkpfekagrfdqqsmvcgqchvey
yfdgknkavkfpwddgmkvenmeqyydkiafsdwtnslsktpmlkaqnpeyetwtagihg
knnvtcidchmpkvqnaegklytdhkignpfdnfaqtcanchtqdkaalqkvvaerkqsi
ndlkikvedqlvhahfeakaaldagateaemkpiqddirhaqwrwdlaiashgihmhape
eglrmlgtamdkaadartklarllatkgitheiqipdistkekaqqaiglnmeqikaekq
dfiktvipqweeqarknglls

Timeline for d4wjyb_:

• d4wjyb_ first appeared in SCOPe 2.05
  
• d4wjyb_ appears in SCOPe 2.06
  
• d4wjyb_ appears in the current release, SCOPe 2.08