Lineage for d4wjyb_ (4wjy B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016605Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 2016606Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 2016749Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins)
    the main characteristic feature of this motif is the packing of its two hemes
    many members contains one or more complete motifs flanked by incomplete motifs and/or other domains
  6. 2016843Protein automated matches [190276] (11 species)
    not a true protein
  7. 2016880Species Escherichia coli [TaxId:83333] [269982] (1 PDB entry)
  8. 2016882Domain d4wjyb_: 4wjy B: [269984]
    automated match to d1gu6a_
    complexed with ca, edo, hem

Details for d4wjyb_

PDB Entry: 4wjy (more details), 2.15 Å

PDB Description: esherichia coli nitrite reductase nrfa h264n
PDB Compounds: (B:) Cytochrome c-552

SCOPe Domain Sequences for d4wjyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wjyb_ a.138.1.3 (B:) automated matches {Escherichia coli [TaxId: 83333]}
tveaknetfapqhpdqylswkatseqservdalaedprlvilwagypfsrdynkprghaf
avtdvretlrtgapknaedgplpmacwsckspdvarliqkdgedgyfhgkwarggpeivn
nlgcadchntaspefakgkpeltlsrpyaarameaigkpfekagrfdqqsmvcgqchvey
yfdgknkavkfpwddgmkvenmeqyydkiafsdwtnslsktpmlkaqnpeyetwtagihg
knnvtcidchmpkvqnaegklytdhkignpfdnfaqtcanchtqdkaalqkvvaerkqsi
ndlkikvedqlvhahfeakaaldagateaemkpiqddirhaqwrwdlaiashgihmhape
eglrmlgtamdkaadartklarllatkgitheiqipdistkekaqqaiglnmeqikaekq
dfiktvipqweeqarknglls

SCOPe Domain Coordinates for d4wjyb_:

Click to download the PDB-style file with coordinates for d4wjyb_.
(The format of our PDB-style files is described here.)

Timeline for d4wjyb_: