Lineage for d4wjya_ (4wjy A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2347197Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 2347198Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 2347351Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins)
    the main characteristic feature of this motif is the packing of its two hemes
    many members contains one or more complete motifs flanked by incomplete motifs and/or other domains
  6. 2347446Protein automated matches [190276] (12 species)
    not a true protein
  7. 2347483Species Escherichia coli [TaxId:83333] [269982] (1 PDB entry)
  8. 2347484Domain d4wjya_: 4wjy A: [269983]
    automated match to d1gu6a_
    complexed with ca, edo, hem

Details for d4wjya_

PDB Entry: 4wjy (more details), 2.15 Å

PDB Description: esherichia coli nitrite reductase nrfa h264n
PDB Compounds: (A:) Cytochrome c-552

SCOPe Domain Sequences for d4wjya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wjya_ a.138.1.3 (A:) automated matches {Escherichia coli [TaxId: 83333]}
tveaknetfapqhpdqylswkatseqservdalaedprlvilwagypfsrdynkprghaf
avtdvretlrtgapknaedgplpmacwsckspdvarliqkdgedgyfhgkwarggpeivn
nlgcadchntaspefakgkpeltlsrpyaarameaigkpfekagrfdqqsmvcgqchvey
yfdgknkavkfpwddgmkvenmeqyydkiafsdwtnslsktpmlkaqnpeyetwtagihg
knnvtcidchmpkvqnaegklytdhkignpfdnfaqtcanchtqdkaalqkvvaerkqsi
ndlkikvedqlvhahfeakaaldagateaemkpiqddirhaqwrwdlaiashgihmhape
eglrmlgtamdkaadartklarllatkgitheiqipdistkekaqqaiglnmeqikaekq
dfiktvipqweeqarknglls

SCOPe Domain Coordinates for d4wjya_:

Click to download the PDB-style file with coordinates for d4wjya_.
(The format of our PDB-style files is described here.)

Timeline for d4wjya_: