Lineage for d1evha_ (1evh A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2070980Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2070981Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2071370Family b.55.1.4: Enabled/VASP homology 1 domain (EVH1 domain) [50767] (7 proteins)
  6. 2071378Protein Enabled [50768] (2 species)
  7. 2071385Species Mouse (Mus musculus) [TaxId:10090] [50769] (1 PDB entry)
  8. 2071386Domain d1evha_: 1evh A: [26997]

Details for d1evha_

PDB Entry: 1evh (more details), 1.8 Å

PDB Description: evh1 domain from murine enabled in complex with acta peptide
PDB Compounds: (A:) protein (mena evh1 domain)

SCOPe Domain Sequences for d1evha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1evha_ b.55.1.4 (A:) Enabled {Mouse (Mus musculus) [TaxId: 10090]}
seqsicqaraavmvyddankkwvpaggstgfsrvhiyhhtgnntfrvvgrkiqdhqvvin
caipkglkynqatqtfhqwrdarqvyglnfgskedanvfasammhalevln

SCOPe Domain Coordinates for d1evha_:

Click to download the PDB-style file with coordinates for d1evha_.
(The format of our PDB-style files is described here.)

Timeline for d1evha_: