SCOPe 2.06: Domain d1evha_: 1evh A:

Lineage for d1evha_ (1evh A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.4: Enabled/VASP homology 1 domain (EVH1 domain) [50767] (7 proteins)

6. Protein Enabled [50768] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [50769] (1 PDB entry)

8. Domain d1evha_: 1evh A: [26997]

Details for d1evha_

PDB Entry: 1evh, 1.8 Å

PDB Description: evh1 domain from murine enabled in complex with acta peptide

PDB Compounds: (A:) protein (mena evh1 domain)

SCOPe Domain Sequences for d1evha_:

Sequence; same for both SEQRES and ATOM records:

>d1evha_ b.55.1.4 (A:) Enabled {Mouse (Mus musculus) [TaxId: 10090]}
seqsicqaraavmvyddankkwvpaggstgfsrvhiyhhtgnntfrvvgrkiqdhqvvin
caipkglkynqatqtfhqwrdarqvyglnfgskedanvfasammhalevln

Timeline for d1evha_:

• d1evha_ first appeared (with stable ids) in SCOP 1.55
  
• d1evha_ appears in SCOPe 2.05
  
• d1evha_ appears in SCOPe 2.07
  
• d1evha_ appears in the current release, SCOPe 2.08