PDB entry 1evh
View 1evh on RCSB PDB site
Description: evh1 domain from murine enabled in complex with acta peptide
Class: contractile protein
Keywords: molecular recognition, actin dynamics, contractile protein
Deposited on
1999-04-21, released
1999-05-21
The last revision prior to the SCOPe 2.06 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.23
AEROSPACI score: 0.47
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: protein (mena evh1 domain)
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d1evha_ - Chain 'B':
Compound: Peptide ACTA
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>1evhA (A:)
mseqsicqaraavmvyddankkwvpaggstgfsrvhiyhhtgnntfrvvgrkiqdhqvvi
ncaipkglkynqatqtfhqwrdarqvyglnfgskedanvfasammhalevln
Sequence, based on observed residues (ATOM records): (download)
>1evhA (A:)
seqsicqaraavmvyddankkwvpaggstgfsrvhiyhhtgnntfrvvgrkiqdhqvvin
caipkglkynqatqtfhqwrdarqvyglnfgskedanvfasammhalevln
- Chain 'B':
No sequence available.