Lineage for d1evha_ (1evh A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 16243Fold b.55: PH domain-like [50728] (1 superfamily)
  4. 16244Superfamily b.55.1: PH domain-like [50729] (5 families) (S)
  5. 16328Family b.55.1.4: Enabled/VASP homology 1 domain (EVH1 domain) [50767] (4 proteins)
  6. 16333Protein Enabled [50768] (1 species)
  7. 16334Species Mouse (Mus musculus) [TaxId:10090] [50769] (1 PDB entry)
  8. 16335Domain d1evha_: 1evh A: [26997]

Details for d1evha_

PDB Entry: 1evh (more details), 1.8 Å

PDB Description: evh1 domain from murine enabled in complex with acta peptide

SCOP Domain Sequences for d1evha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1evha_ b.55.1.4 (A:) Enabled {Mouse (Mus musculus)}
seqsicqaraavmvyddankkwvpaggstgfsrvhiyhhtgnntfrvvgrkiqdhqvvin
caipkglkynqatqtfhqwrdarqvyglnfgskedanvfasammhalevln

SCOP Domain Coordinates for d1evha_:

Click to download the PDB-style file with coordinates for d1evha_.
(The format of our PDB-style files is described here.)

Timeline for d1evha_: