Lineage for d1evha_ (1evh A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.55: PH domain-like [50728] (1 superfamily) Superfamily b.55.1: PH domain-like [50729] (5 families) 
Family b.55.1.4: Enabled/VASP homology 1 domain (EVH1 domain) [50767] (4 proteins) 
Protein Enabled [50768] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [50769] (1 PDB entry) 
Domain d1evha_: 1evh A: [26997]
Details for d1evha_
PDB Entry: 1evh (more details), 1.8 Å
PDB Description: evh1 domain from murine enabled in complex with acta peptide
SCOP Domain Sequences for d1evha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1evha_ b.55.1.4 (A:) Enabled {Mouse (Mus musculus)}
seqsicqaraavmvyddankkwvpaggstgfsrvhiyhhtgnntfrvvgrkiqdhqvvin
caipkglkynqatqtfhqwrdarqvyglnfgskedanvfasammhalevln
SCOP Domain Coordinates for d1evha_:
Click to download the PDB-style file with coordinates for d1evha_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1evha_:
- d1evha_ appears in SCOP 1.57
- d1evha_ appears in the current release, SCOPe 2.08
View in 3D