Lineage for d2nmba_ (2nmb A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2412582Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2412583Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2412882Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins)
    Pfam PF00640
  6. 2412924Protein Numb [50762] (3 species)
  7. 2412925Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [50763] (2 PDB entries)
  8. 2412927Domain d2nmba_: 2nmb A: [26994]
    complexed with a phosphotyrosine peptide

Details for d2nmba_

PDB Entry: 2nmb (more details)

PDB Description: dnumb ptb domain complexed with a phosphotyrosine peptide, nmr, ensemble of structures.
PDB Compounds: (A:) protein (numb protein)

SCOPe Domain Sequences for d2nmba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nmba_ b.55.1.2 (A:) Numb {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
skphqwqadeeavrsatcsfsvkylgcvevfesrgmqvceealkvlrqsrrrpvrgllhv
sgdglrvvddetkglivdqtiekvsfcapdrnhergfsyicrdgttrrwmchgflackds
gerlshavgcafavclerkqrrtraaa

SCOPe Domain Coordinates for d2nmba_:

Click to download the PDB-style file with coordinates for d2nmba_.
(The format of our PDB-style files is described here.)

Timeline for d2nmba_: