Lineage for d2nmba_ (2nmb A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.55: PH domain-like [50728] (1 superfamily) Superfamily b.55.1: PH domain-like [50729] (5 families) 
Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (4 proteins) 
Protein Numb [50762] (1 species) Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [50763] (2 PDB entries) 
Domain d2nmba_: 2nmb A: [26994]
Details for d2nmba_
PDB Entry: 2nmb (more details)
PDB Description: dnumb ptb domain complexed with a phosphotyrosine peptide, nmr, ensemble of structures.
SCOP Domain Sequences for d2nmba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nmba_ b.55.1.2 (A:) Numb {Fruit fly (Drosophila melanogaster)}
skphqwqadeeavrsatcsfsvkylgcvevfesrgmqvceealkvlrqsrrrpvrgllhv
sgdglrvvddetkglivdqtiekvsfcapdrnhergfsyicrdgttrrwmchgflackds
gerlshavgcafavclerkqrrtraaa
SCOP Domain Coordinates for d2nmba_:
Click to download the PDB-style file with coordinates for d2nmba_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2nmba_:
- d2nmba_ appears in SCOP 1.57
- d2nmba_ appears in the current release, SCOPe 2.08
View in 3D