SCOPe 2.06: Domain d2nmba_: 2nmb A:

Lineage for d2nmba_ (2nmb A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins)
   Pfam PF00640

6. Protein Numb [50762] (3 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [50763] (2 PDB entries)

8. Domain d2nmba_: 2nmb A: [26994]
   complexed with a phosphotyrosine peptide

Details for d2nmba_

PDB Entry: 2nmb

PDB Description: dnumb ptb domain complexed with a phosphotyrosine peptide, nmr, ensemble of structures.

PDB Compounds: (A:) protein (numb protein)

SCOPe Domain Sequences for d2nmba_:

Sequence; same for both SEQRES and ATOM records:

>d2nmba_ b.55.1.2 (A:) Numb {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
skphqwqadeeavrsatcsfsvkylgcvevfesrgmqvceealkvlrqsrrrpvrgllhv
sgdglrvvddetkglivdqtiekvsfcapdrnhergfsyicrdgttrrwmchgflackds
gerlshavgcafavclerkqrrtraaa

Timeline for d2nmba_:

• d2nmba_ first appeared (with stable ids) in SCOP 1.55
  
• d2nmba_ appears in SCOPe 2.05
  
• d2nmba_ appears in SCOPe 2.07
  
• d2nmba_ appears in the current release, SCOPe 2.08