Lineage for d1x11b_ (1x11 B:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.55: PH domain-like [50728] (1 superfamily) Superfamily b.55.1: PH domain-like [50729] (5 families) 
Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (4 proteins) 
Protein X11 [50756] (1 species) Species Human (Homo sapiens) [TaxId:9606] [50757] (2 PDB entries) 
Domain d1x11b_: 1x11 B: [26986]
Details for d1x11b_
PDB Entry: 1x11 (more details), 2.4 Å
PDB Description: x11 ptb domain
SCOP Domain Sequences for d1x11b_:
Sequence, based on SEQRES records: (download)
>d1x11b_ b.55.1.2 (B:) X11 {Human (Homo sapiens)}
iifaanylgstqllsdktpsknvrmmqaqeavsrikmaqklaksrkkapegesqpmtevd
lfiltqrikvlnadtqetmmdhplrtisyiadignivvlmarrriprsnsqenveashps
qdgkrqykmichvfesedaqliaqsigqafsvayqeflranginp
Sequence, based on observed residues (ATOM records): (download)
>d1x11b_ b.55.1.2 (B:) X11 {Human (Homo sapiens)}
iifaanylgstqllvrmmqaqeavsrikmaqklaksmtevdlfiltqrikvlnadtqetm
mdhplrtisyiadignivvlmarykmichvfesedaqliaqsigqafsvayqeflrangi
np
SCOP Domain Coordinates for d1x11b_:
Click to download the PDB-style file with coordinates for d1x11b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1x11b_:
- d1x11b_ appears in SCOP 1.57
- d1x11b_ appears in the current release, SCOPe 2.08
View in 3D
