SCOPe 2.08: Domain d4ppia1: 4ppi A:85-196

Lineage for d4ppia1 (4ppi A:85-196)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein Apoptosis regulator Bcl-xL [56856] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56857] (51 PDB entries)

8. Domain d4ppia1: 4ppi A:85-196 [269752]
   Other proteins in same PDB: d4ppia2
   automated match to d2o1ya_
   complexed with gol
   heterogeneous fold; applies to domains that adopt a different fold than the exemplar domain but has similar sequence and number of secondary structures

Details for d4ppia1

PDB Entry: 4ppi, 2.85 Å

PDB Description: crystal structure of bcl-xl hexamer

PDB Compounds: (A:) Bcl-2-like protein 1

SCOPe Domain Sequences for d4ppia1:

Sequence; same for both SEQRES and ATOM records:

>d4ppia1 f.1.4.1 (A:85-196) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]}
avkqalreagdefelryrrafsdltsqlhitpgtayqsfeqvvnelfrdgvnwgrivaff
sfggalcvesvdkemqvlvsriaawmatylndhlepwiqenggwdtfvelyg

Timeline for d4ppia1:

• d4ppia1 first appeared in SCOPe 2.05, called d4ppia_
  
• d4ppia1 was called d4ppia_ in SCOPe 2.07