Class b: All beta proteins [48724] (180 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
Protein automated matches [227017] (58 species) not a true protein |
Species Influenza A virus, different strains [TaxId:11320] [228462] (34 PDB entries) |
Domain d4wsxe_: 4wsx E: [269493] Other proteins in same PDB: d4wsxb_, d4wsxd_, d4wsxf_, d4wsxh_, d4wsxj_, d4wsxl_, d4wsxn_, d4wsxp_, d4wsxr_, d4wsxt_, d4wsxv_, d4wsxx_ automated match to d3gbna_ complexed with nag |
PDB Entry: 4wsx (more details), 2.7 Å
SCOPe Domain Sequences for d4wsxe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wsxe_ b.19.1.0 (E:) automated matches {Influenza A virus, different strains [TaxId: 11320]} gdkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchpigm ligtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgftygs sinsagttracmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihhps stqekndlygtqslsisvgsstyrnnfvpvvgarpqvngqsgridfhwtlvqpgdnitfs hnggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcp kyvnrrslmlatgmrnvpe
Timeline for d4wsxe_: