Lineage for d4wsxr_ (4wsx R:)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2591558Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2591559Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2591560Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 protein domains)
  6. 2592030Protein automated matches [254646] (28 species)
    not a true protein
  7. 2592219Species Influenza A virus, different strains [TaxId:11320] [255822] (26 PDB entries)
  8. 2592288Domain d4wsxr_: 4wsx R: [269505]
    Other proteins in same PDB: d4wsxa_, d4wsxc_, d4wsxe_, d4wsxg_, d4wsxi_, d4wsxk_, d4wsxm_, d4wsxo_, d4wsxq_, d4wsxs_, d4wsxu_, d4wsxw_
    automated match to d4d00d_
    complexed with nag

Details for d4wsxr_

PDB Entry: 4wsx (more details), 2.7 Å

PDB Description: the crystal structure of hemagglutinin from a/jiangxi-donghu/346/2013 influenza virus
PDB Compounds: (R:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d4wsxr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wsxr_ h.3.1.1 (R:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektn
tefesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln

SCOPe Domain Coordinates for d4wsxr_:

Click to download the PDB-style file with coordinates for d4wsxr_.
(The format of our PDB-style files is described here.)

Timeline for d4wsxr_: