PDB entry 4wsx

View 4wsx on RCSB PDB site
Description: The crystal structure of hemagglutinin from A/Jiangxi-Donghu/346/2013 influenza virus
Class: viral protein
Keywords: Hemagglutinin, influenza virus, H10, VIRAL PROTEIN
Deposited on 2014-10-28, released 2015-02-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-01, with a file datestamp of 2015-03-27.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WSX
    Domains in SCOPe 2.07: d4wsxa_
  • Chain 'B':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WSX (0-End)
    Domains in SCOPe 2.07: d4wsxb_
  • Chain 'C':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WSX
    Domains in SCOPe 2.07: d4wsxc_
  • Chain 'D':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WSX (0-End)
    Domains in SCOPe 2.07: d4wsxd_
  • Chain 'E':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WSX
    Domains in SCOPe 2.07: d4wsxe_
  • Chain 'F':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WSX (0-End)
    Domains in SCOPe 2.07: d4wsxf_
  • Chain 'G':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WSX
    Domains in SCOPe 2.07: d4wsxg_
  • Chain 'H':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WSX (0-End)
    Domains in SCOPe 2.07: d4wsxh_
  • Chain 'I':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WSX
    Domains in SCOPe 2.07: d4wsxi_
  • Chain 'J':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WSX (0-End)
    Domains in SCOPe 2.07: d4wsxj_
  • Chain 'K':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WSX
    Domains in SCOPe 2.07: d4wsxk_
  • Chain 'L':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WSX (0-End)
    Domains in SCOPe 2.07: d4wsxl_
  • Chain 'M':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WSX
    Domains in SCOPe 2.07: d4wsxm_
  • Chain 'N':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WSX (0-End)
    Domains in SCOPe 2.07: d4wsxn_
  • Chain 'O':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WSX
    Domains in SCOPe 2.07: d4wsxo_
  • Chain 'P':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WSX (0-End)
    Domains in SCOPe 2.07: d4wsxp_
  • Chain 'Q':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WSX
    Domains in SCOPe 2.07: d4wsxq_
  • Chain 'R':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WSX (0-End)
    Domains in SCOPe 2.07: d4wsxr_
  • Chain 'S':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WSX
    Domains in SCOPe 2.07: d4wsxs_
  • Chain 'T':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WSX (0-End)
    Domains in SCOPe 2.07: d4wsxt_
  • Chain 'U':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WSX
    Domains in SCOPe 2.07: d4wsxu_
  • Chain 'V':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WSX (0-End)
    Domains in SCOPe 2.07: d4wsxv_
  • Chain 'W':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WSX
    Domains in SCOPe 2.07: d4wsxw_
  • Chain 'X':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4WSX (0-End)
    Domains in SCOPe 2.07: d4wsxx_
  • Heterogens: NAG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4wsxA (A:)
    adpgdkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchp
    igmligtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgft
    ygssinsagttracmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgih
    hpsstqekndlygtqslsisvgsstyrnnfvpvvgarpqvngqsgridfhwtlvqpgdni
    tfshnggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvg
    qcpkyvnrrslmlatgmrnvpeliqgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wsxA (A:)
    gdkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchpigm
    ligtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgftygs
    sinsagttracmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihhps
    stqekndlygtqslsisvgsstyrnnfvpvvgarpqvngqsgridfhwtlvqpgdnitfs
    hnggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcp
    kyvnrrslmlatgmrnvpe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4wsxB (B:)
    glfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektn
    tefesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
    rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrlnin
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wsxB (B:)
    glfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektn
    tefesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
    rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4wsxC (C:)
    adpgdkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchp
    igmligtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgft
    ygssinsagttracmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgih
    hpsstqekndlygtqslsisvgsstyrnnfvpvvgarpqvngqsgridfhwtlvqpgdni
    tfshnggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvg
    qcpkyvnrrslmlatgmrnvpeliqgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wsxC (C:)
    gdkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchpigm
    ligtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgftygs
    sinsagttracmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihhps
    stqekndlygtqslsisvgsstyrnnfvpvvgarpqvngqsgridfhwtlvqpgdnitfs
    hnggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcp
    kyvnrrslmlatgmrnvpe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4wsxD (D:)
    glfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektn
    tefesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
    rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrlnin
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wsxD (D:)
    glfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektn
    tefesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
    rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4wsxE (E:)
    adpgdkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchp
    igmligtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgft
    ygssinsagttracmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgih
    hpsstqekndlygtqslsisvgsstyrnnfvpvvgarpqvngqsgridfhwtlvqpgdni
    tfshnggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvg
    qcpkyvnrrslmlatgmrnvpeliqgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wsxE (E:)
    gdkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchpigm
    ligtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgftygs
    sinsagttracmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihhps
    stqekndlygtqslsisvgsstyrnnfvpvvgarpqvngqsgridfhwtlvqpgdnitfs
    hnggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcp
    kyvnrrslmlatgmrnvpe
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4wsxF (F:)
    glfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektn
    tefesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
    rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrlnin
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wsxF (F:)
    glfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektn
    tefesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
    rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4wsxG (G:)
    adpgdkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchp
    igmligtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgft
    ygssinsagttracmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgih
    hpsstqekndlygtqslsisvgsstyrnnfvpvvgarpqvngqsgridfhwtlvqpgdni
    tfshnggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvg
    qcpkyvnrrslmlatgmrnvpeliqgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wsxG (G:)
    gdkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchpigm
    ligtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgftygs
    sinsagttracmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihhps
    stqekndlygtqslsisvgsstyrnnfvpvvgarpqvngqsgridfhwtlvqpgdnitfs
    hnggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcp
    kyvnrrslmlatgmrnvpe
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4wsxH (H:)
    glfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektn
    tefesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
    rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrlnin
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wsxH (H:)
    glfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektn
    tefesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
    rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4wsxI (I:)
    adpgdkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchp
    igmligtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgft
    ygssinsagttracmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgih
    hpsstqekndlygtqslsisvgsstyrnnfvpvvgarpqvngqsgridfhwtlvqpgdni
    tfshnggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvg
    qcpkyvnrrslmlatgmrnvpeliqgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wsxI (I:)
    gdkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchpigm
    ligtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgftygs
    sinsagttracmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihhps
    stqekndlygtqslsisvgsstyrnnfvpvvgarpqvngqsgridfhwtlvqpgdnitfs
    hnggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcp
    kyvnrrslmlatgmrnvpe
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4wsxJ (J:)
    glfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektn
    tefesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
    rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrlnin
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wsxJ (J:)
    glfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektn
    tefesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
    rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4wsxK (K:)
    adpgdkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchp
    igmligtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgft
    ygssinsagttracmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgih
    hpsstqekndlygtqslsisvgsstyrnnfvpvvgarpqvngqsgridfhwtlvqpgdni
    tfshnggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvg
    qcpkyvnrrslmlatgmrnvpeliqgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wsxK (K:)
    gdkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchpigm
    ligtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgftygs
    sinsagttracmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihhps
    stqekndlygtqslsisvgsstyrnnfvpvvgarpqvngqsgridfhwtlvqpgdnitfs
    hnggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcp
    kyvnrrslmlatgmrnvpe
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4wsxL (L:)
    glfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektn
    tefesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
    rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrlnin
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wsxL (L:)
    glfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektn
    tefesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
    rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4wsxM (M:)
    adpgdkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchp
    igmligtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgft
    ygssinsagttracmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgih
    hpsstqekndlygtqslsisvgsstyrnnfvpvvgarpqvngqsgridfhwtlvqpgdni
    tfshnggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvg
    qcpkyvnrrslmlatgmrnvpeliqgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wsxM (M:)
    gdkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchpigm
    ligtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgftygs
    sinsagttracmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihhps
    stqekndlygtqslsisvgsstyrnnfvpvvgarpqvngqsgridfhwtlvqpgdnitfs
    hnggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcp
    kyvnrrslmlatgmrnvpe
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >4wsxN (N:)
    glfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektn
    tefesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
    rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrlnin
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wsxN (N:)
    glfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektn
    tefesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
    rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >4wsxO (O:)
    adpgdkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchp
    igmligtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgft
    ygssinsagttracmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgih
    hpsstqekndlygtqslsisvgsstyrnnfvpvvgarpqvngqsgridfhwtlvqpgdni
    tfshnggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvg
    qcpkyvnrrslmlatgmrnvpeliqgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wsxO (O:)
    gdkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchpigm
    ligtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgftygs
    sinsagttracmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihhps
    stqekndlygtqslsisvgsstyrnnfvpvvgarpqvngqsgridfhwtlvqpgdnitfs
    hnggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcp
    kyvnrrslmlatgmrnvpe
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >4wsxP (P:)
    glfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektn
    tefesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
    rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrlnin
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wsxP (P:)
    glfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektn
    tefesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
    rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >4wsxQ (Q:)
    adpgdkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchp
    igmligtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgft
    ygssinsagttracmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgih
    hpsstqekndlygtqslsisvgsstyrnnfvpvvgarpqvngqsgridfhwtlvqpgdni
    tfshnggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvg
    qcpkyvnrrslmlatgmrnvpeliqgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wsxQ (Q:)
    gdkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchpigm
    ligtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgftygs
    sinsagttracmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihhps
    stqekndlygtqslsisvgsstyrnnfvpvvgarpqvngqsgridfhwtlvqpgdnitfs
    hnggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcp
    kyvnrrslmlatgmrnvpe
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >4wsxR (R:)
    glfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektn
    tefesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
    rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrlnin
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wsxR (R:)
    glfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektn
    tefesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
    rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >4wsxS (S:)
    adpgdkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchp
    igmligtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgft
    ygssinsagttracmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgih
    hpsstqekndlygtqslsisvgsstyrnnfvpvvgarpqvngqsgridfhwtlvqpgdni
    tfshnggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvg
    qcpkyvnrrslmlatgmrnvpeliqgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wsxS (S:)
    gdkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchpigm
    ligtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgftygs
    sinsagttracmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihhps
    stqekndlygtqslsisvgsstyrnnfvpvvgarpqvngqsgridfhwtlvqpgdnitfs
    hnggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcp
    kyvnrrslmlatgmrnvpe
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >4wsxT (T:)
    glfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektn
    tefesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
    rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrlnin
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wsxT (T:)
    glfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektn
    tefesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
    rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >4wsxU (U:)
    adpgdkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchp
    igmligtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgft
    ygssinsagttracmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgih
    hpsstqekndlygtqslsisvgsstyrnnfvpvvgarpqvngqsgridfhwtlvqpgdni
    tfshnggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvg
    qcpkyvnrrslmlatgmrnvpeliqgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wsxU (U:)
    gdkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchpigm
    ligtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgftygs
    sinsagttracmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihhps
    stqekndlygtqslsisvgsstyrnnfvpvvgarpqvngqsgridfhwtlvqpgdnitfs
    hnggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcp
    kyvnrrslmlatgmrnvpe
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >4wsxV (V:)
    glfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektn
    tefesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
    rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrlnin
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wsxV (V:)
    glfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektn
    tefesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
    rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >4wsxW (W:)
    adpgdkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchp
    igmligtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgft
    ygssinsagttracmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgih
    hpsstqekndlygtqslsisvgsstyrnnfvpvvgarpqvngqsgridfhwtlvqpgdni
    tfshnggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvg
    qcpkyvnrrslmlatgmrnvpeliqgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wsxW (W:)
    gdkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchpigm
    ligtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgftygs
    sinsagttracmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihhps
    stqekndlygtqslsisvgsstyrnnfvpvvgarpqvngqsgridfhwtlvqpgdnitfs
    hnggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcp
    kyvnrrslmlatgmrnvpe
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >4wsxX (X:)
    glfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektn
    tefesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
    rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrlnin
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wsxX (X:)
    glfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektn
    tefesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye
    rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrln