Lineage for d4wsxg_ (4wsx G:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2776220Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2776221Protein automated matches [227017] (58 species)
    not a true protein
  7. 2776662Species Influenza A virus, different strains [TaxId:11320] [228462] (34 PDB entries)
  8. 2776725Domain d4wsxg_: 4wsx G: [269495]
    Other proteins in same PDB: d4wsxb_, d4wsxd_, d4wsxf_, d4wsxh_, d4wsxj_, d4wsxl_, d4wsxn_, d4wsxp_, d4wsxr_, d4wsxt_, d4wsxv_, d4wsxx_
    automated match to d3gbna_
    complexed with nag

Details for d4wsxg_

PDB Entry: 4wsx (more details), 2.7 Å

PDB Description: the crystal structure of hemagglutinin from a/jiangxi-donghu/346/2013 influenza virus
PDB Compounds: (G:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d4wsxg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wsxg_ b.19.1.0 (G:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
gdkiclghhavangtivktltneqeevtnatetvestginrlcmkgrkhkdlgnchpigm
ligtpacdlhltgmwdtlierenaiaycypgatvnvealrqkimesgginkistgftygs
sinsagttracmrnggnsfyaelkwlvskskgqnfpqttntyrntdtaehlimwgihhps
stqekndlygtqslsisvgsstyrnnfvpvvgarpqvngqsgridfhwtlvqpgdnitfs
hnggliapsrvskligrglgiqsdapidnnceskcfwrggsintrlpfqnlsprtvgqcp
kyvnrrslmlatgmrnvpe

SCOPe Domain Coordinates for d4wsxg_:

Click to download the PDB-style file with coordinates for d4wsxg_.
(The format of our PDB-style files is described here.)

Timeline for d4wsxg_: