SCOP 1.63: Domain d1gsgp1: 1gsg P:339-547

Lineage for d1gsgp1 (1gsg P:339-547)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.53: Ribosomal protein L25-like [50714] (1 superfamily)
   barrel, closed; n=6, S=10; complex topology

4. Superfamily b.53.1: Ribosomal protein L25-like [50715] (2 families)

5. Family b.53.1.2: Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain [50719] (1 protein)

6. Protein Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain [50720] (1 species)
   duplication, consists of two barrel domains with the swapping of N-terminal strands

7. Species Escherichia coli [TaxId:562] [50721] (11 PDB entries)

8. Domain d1gsgp1: 1gsg P:339-547 [26948]
   Other proteins in same PDB: d1gsgp2
   protein/tRNA complex

Details for d1gsgp1

PDB Entry: 1gsg, 2.8 Å

PDB Description: Structure of E.coli glutaminyl-tRNA synthetase complexed with trnagln and ATP at 2.8 Angstroms resolution

SCOP Domain Sequences for d1gsgp1:

Sequence, based on SEQRES records:

>d1gsgp1 b.53.1.2 (P:339-547) Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain {Escherichia coli}
apramavidpvklvienyqgegemvtmpnhpnkpemgsrqvpfsgeiwidradfreeank
qykrlvlgkevrlrnayvikaervekdaegnittifctydadtlskdpadgrkvkgvihw
vsaahalpveirlydrlfsvpnpgaaddflsvinpeslvikqgfaepslkdavagkafqf
eregyfcldsrhstaekpvfnrtvglrdt

Sequence, based on observed residues (ATOM records):

>d1gsgp1 b.53.1.2 (P:339-547) Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain {Escherichia coli}
apramavidpvklvienyqgegemvtmpnhpnkpemgsrqvpfsgeiwidradfreeank
qykrlvlgkevrlrnayvikaervekdaegnittifctydagvihwvsaahalpveirly
drlfsvpnpgaaddflsvinpeslvikqgfaepslkdavagkafqferegyfcldsrhst
aekpvfnrtvglrdt

Timeline for d1gsgp1:

• d1gsgp1 first appeared (with stable ids) in SCOP 1.55
  
• d1gsgp1 appears in SCOP 1.61
  
• d1gsgp1 appears in SCOP 1.65
  
• d1gsgp1 appears in the current release, SCOPe 2.08