Lineage for d1gsgp1 (1gsg P:339-547)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 16214Fold b.53: Ribosomal protein L25-like [50714] (1 superfamily)
  4. 16215Superfamily b.53.1: Ribosomal protein L25-like [50715] (2 families) (S)
  5. 16222Family b.53.1.2: Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain [50719] (1 protein)
  6. 16223Protein Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain [50720] (1 species)
  7. 16224Species Escherichia coli [TaxId:562] [50721] (10 PDB entries)
  8. 16234Domain d1gsgp1: 1gsg P:339-547 [26948]
    Other proteins in same PDB: d1gsgp2

Details for d1gsgp1

PDB Entry: 1gsg (more details), 2.8 Å

PDB Description: Structure of E.coli glutaminyl-tRNA synthetase complexed with trnagln and ATP at 2.8 Angstroms resolution

SCOP Domain Sequences for d1gsgp1:

Sequence, based on SEQRES records: (download)

>d1gsgp1 b.53.1.2 (P:339-547) Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain {Escherichia coli}
apramavidpvklvienyqgegemvtmpnhpnkpemgsrqvpfsgeiwidradfreeank
qykrlvlgkevrlrnayvikaervekdaegnittifctydadtlskdpadgrkvkgvihw
vsaahalpveirlydrlfsvpnpgaaddflsvinpeslvikqgfaepslkdavagkafqf
eregyfcldsrhstaekpvfnrtvglrdt

Sequence, based on observed residues (ATOM records): (download)

>d1gsgp1 b.53.1.2 (P:339-547) Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain {Escherichia coli}
apramavidpvklvienyqgegemvtmpnhpnkpemgsrqvpfsgeiwidradfreeank
qykrlvlgkevrlrnayvikaervekdaegnittifctydagvihwvsaahalpveirly
drlfsvpnpgaaddflsvinpeslvikqgfaepslkdavagkafqferegyfcldsrhst
aekpvfnrtvglrdt

SCOP Domain Coordinates for d1gsgp1:

Click to download the PDB-style file with coordinates for d1gsgp1.
(The format of our PDB-style files is described here.)

Timeline for d1gsgp1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gsgp2