| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
| Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
| Protein Influenza hemagglutinin (stalk) [58066] (22 species) trimer |
| Species Influenza A virus (a/chicken/new york/14677-13/1998(h6n2)) [TaxId:402503] [269458] (2 PDB entries) |
| Domain d4wsrf2: 4wsr F:340-498 [269477] Other proteins in same PDB: d4wsra1, d4wsrb1, d4wsrc1, d4wsrd1, d4wsre1, d4wsrf1 automated match to d1ha0a2 complexed with nag |
PDB Entry: 4wsr (more details), 2.5 Å
SCOPe Domain Sequences for d4wsrf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wsrf2 h.3.1.1 (F:340-498) Influenza hemagglutinin (stalk) {Influenza A virus (a/chicken/new york/14677-13/1998(h6n2)) [TaxId: 402503]}
ggwtgmvdgwygyhhensqgsgyaadkestqkaidgitnkvnsiidkmntqfeavehefs
nlekrisnlnkrmedgfldvwtynaellvllenertldmhdanvknlhekvksqlrdnak
dlgngcfefwhkcdnecinsvkngtynypkyqeesrlnr
Timeline for d4wsrf2: