Lineage for d4wsrf2 (4wsr F:340-498)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3040827Protein Influenza hemagglutinin (stalk) [58066] (22 species)
    trimer
  7. 3040843Species Influenza A virus (a/chicken/new york/14677-13/1998(h6n2)) [TaxId:402503] [269458] (2 PDB entries)
  8. 3040849Domain d4wsrf2: 4wsr F:340-498 [269477]
    Other proteins in same PDB: d4wsra1, d4wsrb1, d4wsrc1, d4wsrd1, d4wsre1, d4wsrf1
    automated match to d1ha0a2
    complexed with nag

Details for d4wsrf2

PDB Entry: 4wsr (more details), 2.5 Å

PDB Description: the crystal structure of hemagglutinin form a/chicken/new york/14677- 13/1998
PDB Compounds: (F:) Hemagglutinin

SCOPe Domain Sequences for d4wsrf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wsrf2 h.3.1.1 (F:340-498) Influenza hemagglutinin (stalk) {Influenza A virus (a/chicken/new york/14677-13/1998(h6n2)) [TaxId: 402503]}
ggwtgmvdgwygyhhensqgsgyaadkestqkaidgitnkvnsiidkmntqfeavehefs
nlekrisnlnkrmedgfldvwtynaellvllenertldmhdanvknlhekvksqlrdnak
dlgngcfefwhkcdnecinsvkngtynypkyqeesrlnr

SCOPe Domain Coordinates for d4wsrf2:

Click to download the PDB-style file with coordinates for d4wsrf2.
(The format of our PDB-style files is described here.)

Timeline for d4wsrf2: