![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
![]() | Superfamily b.19.1: Viral protein domain [49818] (4 families) ![]() forms homotrimers |
![]() | Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
![]() | Protein automated matches [227017] (58 species) not a true protein |
![]() | Species Influenza A virus (a/chicken/new york/14677-13/1998(h6n2)) [TaxId:402503] [269456] (2 PDB entries) |
![]() | Domain d4wsre1: 4wsr E:1-324 [269466] Other proteins in same PDB: d4wsra2, d4wsrb2, d4wsrc2, d4wsrd2, d4wsre2, d4wsrf2 automated match to d1ha0a1 complexed with nag |
PDB Entry: 4wsr (more details), 2.5 Å
SCOPe Domain Sequences for d4wsre1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wsre1 b.19.1.0 (E:1-324) automated matches {Influenza A virus (a/chicken/new york/14677-13/1998(h6n2)) [TaxId: 402503]} dkicigyhannsttqvdtileknvtvthsvelletqkesrfcrvlnkapldlgdcttegw ilgnprcdkllgdrswsyiverpdaqngicypgvlkeaeelkaligsidtiqrfemfpks twtgvdtnsgvtsactynggssfyrnllwiikirsdpyslikgtytntgsqsilyfwgvh hppddveqanlyglgtryvrmgtesmnfakgpeiadrppangqrgridyywsvlkpgetl nvesngnliapwyaykftssrhkgaifrsdlpiencdavcqtltgaintnktfqnvspiw igecpkyvkskslklatglrnvpq
Timeline for d4wsre1: