PDB entry 4wsr

View 4wsr on RCSB PDB site
Description: The crystal structure of hemagglutinin form A/chicken/New York/14677-13/1998
Class: viral protein
Keywords: Influenza virus, hemagglutinin, H6, VIRAL PROTEIN
Deposited on 2014-10-28, released 2015-02-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-01, with a file datestamp of 2015-03-27.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/chicken/New York/14677-13/1998(H6N2)) [TaxId:402503]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0A3A5 (4-End)
      • conflict (320)
    Domains in SCOPe 2.07: d4wsra1, d4wsra2
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/chicken/New York/14677-13/1998(H6N2)) [TaxId:402503]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0A3A5 (4-End)
      • conflict (320)
    Domains in SCOPe 2.07: d4wsrb1, d4wsrb2
  • Chain 'C':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/chicken/New York/14677-13/1998(H6N2)) [TaxId:402503]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0A3A5 (4-End)
      • conflict (320)
    Domains in SCOPe 2.07: d4wsrc1, d4wsrc2
  • Chain 'D':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/chicken/New York/14677-13/1998(H6N2)) [TaxId:402503]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0A3A5 (4-End)
      • conflict (320)
    Domains in SCOPe 2.07: d4wsrd1, d4wsrd2
  • Chain 'E':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/chicken/New York/14677-13/1998(H6N2)) [TaxId:402503]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0A3A5 (4-End)
      • conflict (320)
    Domains in SCOPe 2.07: d4wsre1, d4wsre2
  • Chain 'F':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/chicken/New York/14677-13/1998(H6N2)) [TaxId:402503]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0A3A5 (4-End)
      • conflict (320)
    Domains in SCOPe 2.07: d4wsrf1, d4wsrf2
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4wsrA (A:)
    adpgdkicigyhannsttqvdtileknvtvthsvelletqkesrfcrvlnkapldlgdct
    tegwilgnprcdkllgdrswsyiverpdaqngicypgvlkeaeelkaligsidtiqrfem
    fpkstwtgvdtnsgvtsactynggssfyrnllwiikirsdpyslikgtytntgsqsilyf
    wgvhhppddveqanlyglgtryvrmgtesmnfakgpeiadrppangqrgridyywsvlkp
    getlnvesngnliapwyaykftssrhkgaifrsdlpiencdavcqtltgaintnktfqnv
    spiwigecpkyvkskslklatglrnvpqvktrglfgaiagfieggwtgmvdgwygyhhen
    sqgsgyaadkestqkaidgitnkvnsiidkmntqfeavehefsnlekrisnlnkrmedgf
    ldvwtynaellvllenertldmhdanvknlhekvksqlrdnakdlgngcfefwhkcdnec
    insvkngtynypkyqeesrlnrqeiksgrlvprg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wsrA (A:)
    dkicigyhannsttqvdtileknvtvthsvelletqkesrfcrvlnkapldlgdcttegw
    ilgnprcdkllgdrswsyiverpdaqngicypgvlkeaeelkaligsidtiqrfemfpks
    twtgvdtnsgvtsactynggssfyrnllwiikirsdpyslikgtytntgsqsilyfwgvh
    hppddveqanlyglgtryvrmgtesmnfakgpeiadrppangqrgridyywsvlkpgetl
    nvesngnliapwyaykftssrhkgaifrsdlpiencdavcqtltgaintnktfqnvspiw
    igecpkyvkskslklatglrnvpqggwtgmvdgwygyhhensqgsgyaadkestqkaidg
    itnkvnsiidkmntqfeavehefsnlekrisnlnkrmedgfldvwtynaellvllenert
    ldmhdanvknlhekvksqlrdnakdlgngcfefwhkcdnecinsvkngtynypkyqeesr
    lnr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4wsrB (B:)
    adpgdkicigyhannsttqvdtileknvtvthsvelletqkesrfcrvlnkapldlgdct
    tegwilgnprcdkllgdrswsyiverpdaqngicypgvlkeaeelkaligsidtiqrfem
    fpkstwtgvdtnsgvtsactynggssfyrnllwiikirsdpyslikgtytntgsqsilyf
    wgvhhppddveqanlyglgtryvrmgtesmnfakgpeiadrppangqrgridyywsvlkp
    getlnvesngnliapwyaykftssrhkgaifrsdlpiencdavcqtltgaintnktfqnv
    spiwigecpkyvkskslklatglrnvpqvktrglfgaiagfieggwtgmvdgwygyhhen
    sqgsgyaadkestqkaidgitnkvnsiidkmntqfeavehefsnlekrisnlnkrmedgf
    ldvwtynaellvllenertldmhdanvknlhekvksqlrdnakdlgngcfefwhkcdnec
    insvkngtynypkyqeesrlnrqeiksgrlvprg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wsrB (B:)
    dkicigyhannsttqvdtileknvtvthsvelletqkesrfcrvlnkapldlgdcttegw
    ilgnprcdkllgdrswsyiverpdaqngicypgvlkeaeelkaligsidtiqrfemfpks
    twtgvdtnsgvtsactynggssfyrnllwiikirsdpyslikgtytntgsqsilyfwgvh
    hppddveqanlyglgtryvrmgtesmnfakgpeiadrppangqrgridyywsvlkpgetl
    nvesngnliapwyaykftssrhkgaifrsdlpiencdavcqtltgaintnktfqnvspiw
    igecpkyvkskslklatglrnvpggwtgmvdgwygyhhensqgsgyaadkestqkaidgi
    tnkvnsiidkmntqfeavehefsnlekrisnlnkrmedgfldvwtynaellvllenertl
    dmhdanvknlhekvksqlrdnakdlgngcfefwhkcdnecinsvkngtynypkyqeesrl
    nr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4wsrC (C:)
    adpgdkicigyhannsttqvdtileknvtvthsvelletqkesrfcrvlnkapldlgdct
    tegwilgnprcdkllgdrswsyiverpdaqngicypgvlkeaeelkaligsidtiqrfem
    fpkstwtgvdtnsgvtsactynggssfyrnllwiikirsdpyslikgtytntgsqsilyf
    wgvhhppddveqanlyglgtryvrmgtesmnfakgpeiadrppangqrgridyywsvlkp
    getlnvesngnliapwyaykftssrhkgaifrsdlpiencdavcqtltgaintnktfqnv
    spiwigecpkyvkskslklatglrnvpqvktrglfgaiagfieggwtgmvdgwygyhhen
    sqgsgyaadkestqkaidgitnkvnsiidkmntqfeavehefsnlekrisnlnkrmedgf
    ldvwtynaellvllenertldmhdanvknlhekvksqlrdnakdlgngcfefwhkcdnec
    insvkngtynypkyqeesrlnrqeiksgrlvprg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wsrC (C:)
    dkicigyhannsttqvdtileknvtvthsvelletqkesrfcrvlnkapldlgdcttegw
    ilgnprcdkllgdrswsyiverpdaqngicypgvlkeaeelkaligsidtiqrfemfpks
    twtgvdtnsgvtsactynggssfyrnllwiikirsdpyslikgtytntgsqsilyfwgvh
    hppddveqanlyglgtryvrmgtesmnfakgpeiadrppangqrgridyywsvlkpgetl
    nvesngnliapwyaykftssrhkgaifrsdlpiencdavcqtltgaintnktfqnvspiw
    igecpkyvkskslklatglrnvpggwtgmvdgwygyhhensqgsgyaadkestqkaidgi
    tnkvnsiidkmntqfeavehefsnlekrisnlnkrmedgfldvwtynaellvllenertl
    dmhdanvknlhekvksqlrdnakdlgngcfefwhkcdnecinsvkngtynypkyqeesrl
    nr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4wsrD (D:)
    adpgdkicigyhannsttqvdtileknvtvthsvelletqkesrfcrvlnkapldlgdct
    tegwilgnprcdkllgdrswsyiverpdaqngicypgvlkeaeelkaligsidtiqrfem
    fpkstwtgvdtnsgvtsactynggssfyrnllwiikirsdpyslikgtytntgsqsilyf
    wgvhhppddveqanlyglgtryvrmgtesmnfakgpeiadrppangqrgridyywsvlkp
    getlnvesngnliapwyaykftssrhkgaifrsdlpiencdavcqtltgaintnktfqnv
    spiwigecpkyvkskslklatglrnvpqvktrglfgaiagfieggwtgmvdgwygyhhen
    sqgsgyaadkestqkaidgitnkvnsiidkmntqfeavehefsnlekrisnlnkrmedgf
    ldvwtynaellvllenertldmhdanvknlhekvksqlrdnakdlgngcfefwhkcdnec
    insvkngtynypkyqeesrlnrqeiksgrlvprg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wsrD (D:)
    dkicigyhannsttqvdtileknvtvthsvelletqkesrfcrvlnkapldlgdcttegw
    ilgnprcdkllgdrswsyiverpdaqngicypgvlkeaeelkaligsidtiqrfemfpks
    twtgvdtnsgvtsactynggssfyrnllwiikirsdpyslikgtytntgsqsilyfwgvh
    hppddveqanlyglgtryvrmgtesmnfakgpeiadrppangqrgridyywsvlkpgetl
    nvesngnliapwyaykftssrhkgaifrsdlpiencdavcqtltgaintnktfqnvspiw
    igecpkyvkskslklatglrnvpqvktrglfgaiagfieggwtgmvdgwygyhhensqgs
    gyaadkestqkaidgitnkvnsiidkmntqfeavehefsnlekrisnlnkrmedgfldvw
    tynaellvllenertldmhdanvknlhekvksqlrdnakdlgngcfefwhkcdnecinsv
    kngtynypkyqeesrlnr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4wsrE (E:)
    adpgdkicigyhannsttqvdtileknvtvthsvelletqkesrfcrvlnkapldlgdct
    tegwilgnprcdkllgdrswsyiverpdaqngicypgvlkeaeelkaligsidtiqrfem
    fpkstwtgvdtnsgvtsactynggssfyrnllwiikirsdpyslikgtytntgsqsilyf
    wgvhhppddveqanlyglgtryvrmgtesmnfakgpeiadrppangqrgridyywsvlkp
    getlnvesngnliapwyaykftssrhkgaifrsdlpiencdavcqtltgaintnktfqnv
    spiwigecpkyvkskslklatglrnvpqvktrglfgaiagfieggwtgmvdgwygyhhen
    sqgsgyaadkestqkaidgitnkvnsiidkmntqfeavehefsnlekrisnlnkrmedgf
    ldvwtynaellvllenertldmhdanvknlhekvksqlrdnakdlgngcfefwhkcdnec
    insvkngtynypkyqeesrlnrqeiksgrlvprg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wsrE (E:)
    dkicigyhannsttqvdtileknvtvthsvelletqkesrfcrvlnkapldlgdcttegw
    ilgnprcdkllgdrswsyiverpdaqngicypgvlkeaeelkaligsidtiqrfemfpks
    twtgvdtnsgvtsactynggssfyrnllwiikirsdpyslikgtytntgsqsilyfwgvh
    hppddveqanlyglgtryvrmgtesmnfakgpeiadrppangqrgridyywsvlkpgetl
    nvesngnliapwyaykftssrhkgaifrsdlpiencdavcqtltgaintnktfqnvspiw
    igecpkyvkskslklatglrnvpqiagfieggwtgmvdgwygyhhensqgsgyaadkest
    qkaidgitnkvnsiidkmntqfeavehefsnlekrisnlnkrmedgfldvwtynaellvl
    lenertldmhdanvknlhekvksqlrdnakdlgngcfefwhkcdnecinsvkngtynypk
    yqeesrlnr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4wsrF (F:)
    adpgdkicigyhannsttqvdtileknvtvthsvelletqkesrfcrvlnkapldlgdct
    tegwilgnprcdkllgdrswsyiverpdaqngicypgvlkeaeelkaligsidtiqrfem
    fpkstwtgvdtnsgvtsactynggssfyrnllwiikirsdpyslikgtytntgsqsilyf
    wgvhhppddveqanlyglgtryvrmgtesmnfakgpeiadrppangqrgridyywsvlkp
    getlnvesngnliapwyaykftssrhkgaifrsdlpiencdavcqtltgaintnktfqnv
    spiwigecpkyvkskslklatglrnvpqvktrglfgaiagfieggwtgmvdgwygyhhen
    sqgsgyaadkestqkaidgitnkvnsiidkmntqfeavehefsnlekrisnlnkrmedgf
    ldvwtynaellvllenertldmhdanvknlhekvksqlrdnakdlgngcfefwhkcdnec
    insvkngtynypkyqeesrlnrqeiksgrlvprg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wsrF (F:)
    dkicigyhannsttqvdtileknvtvthsvelletqkesrfcrvlnkapldlgdcttegw
    ilgnprcdkllgdrswsyiverpdaqngicypgvlkeaeelkaligsidtiqrfemfpks
    twtgvdtnsgvtsactynggssfyrnllwiikirsdpyslikgtytntgsqsilyfwgvh
    hppddveqanlyglgtryvrmgtesmnfakgpeiadrppangqrgridyywsvlkpgetl
    nvesngnliapwyaykftssrhkgaifrsdlpiencdavcqtltgaintnktfqnvspiw
    igecpkyvkskslklatglrnvggwtgmvdgwygyhhensqgsgyaadkestqkaidgit
    nkvnsiidkmntqfeavehefsnlekrisnlnkrmedgfldvwtynaellvllenertld
    mhdanvknlhekvksqlrdnakdlgngcfefwhkcdnecinsvkngtynypkyqeesrln
    r