![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
![]() | Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
![]() | Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
![]() | Protein Influenza hemagglutinin (stalk) [58066] (22 species) trimer |
![]() | Species Influenza A virus, different strains [TaxId:11320] [58067] (150 PDB entries) |
![]() | Domain d1ha0a2: 1ha0 A:330-502 [45697] Other proteins in same PDB: d1ha0a1 complexed with nag |
PDB Entry: 1ha0 (more details), 2.8 Å
SCOPe Domain Sequences for d1ha0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ha0a2 h.3.1.1 (A:330-502) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]} glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrnealnnrfqi
Timeline for d1ha0a2: