Lineage for d1ha0a2 (1ha0 A:330-502)

  1. Root: SCOP 1.55
  2. Class h: Coiled coil proteins [57942] (5 folds)
  3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
  4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family) (S)
  5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)
  6. Protein Influenza hemagglutinin (stalk) [58066] (2 species)
  7. Species Influenza A virus, different strains [TaxId:11320] [58067] (17 PDB entries)
  8. 42329Domain d1ha0a2: 1ha0 A:330-502 [45697]
    Other proteins in same PDB: d1ha0a1

Details for d1ha0a2

PDB Entry: 1ha0 (more details), 2.8 Å

PDB Description: hemagglutinin precursor ha0

SCOP Domain Sequences for d1ha0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ha0a2 h.3.1.1 (A:330-502) Influenza hemagglutinin (stalk) {Influenza A virus, different strains}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrnealnnrfqi

SCOP Domain Coordinates for d1ha0a2:

Click to download the PDB-style file with coordinates for d1ha0a2.
(The format of our PDB-style files is described here.)

Timeline for d1ha0a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ha0a1