PDB entry 1ha0

View 1ha0 on RCSB PDB site
Description: hemagglutinin precursor ha0
Class: Viral protein
Keywords: GLYCOPROTEIN, MEMBRANE-FUSION PRECURSOR, VIRUS/VIRAL PROTEIN, Viral protein
Deposited on 1998-10-08, released 1998-10-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.224
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (hemagglutinin precursor)
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03437 (0-493)
      • engineered (320)
      • conflict (484)
    Domains in SCOPe 2.07: d1ha0a1, d1ha0a2
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ha0A (A:)
    statlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlid
    allgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwt
    gvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgihhpstn
    qeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvinsn
    gnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpky
    vkqntlklatgmrnvpekqtqglfgaiagfiengwegmidgwygfrhqnsegtgqaadlk
    stqaaidqingklnrviektnekfhqiekefsevegriqdlekyvedtkidlwsynaell
    valenqhtidltdsemnklfektrrqlrenaeemgngcfkiyhkcdnaciesirngtydh
    dvyrnealnnrfqi