SCOPe 2.05: Domain d4wesa_: 4wes A:

Lineage for d4wesa_ (4wes A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.92: Chelatase-like [53799] (3 superfamilies)
   duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families)
   contains a long alpha helical insertion in the interdomain linker

5. Family c.92.2.3: Nitrogenase iron-molybdenum protein [53816] (3 proteins)
   contains three domains of this fold; "Helical backbone" holds domains 2 and 3
   both chains are homologous; the inter-chain arrangement of domains 1 is similar to the intra-chain arrangement of domains 2 and 3
   automatically mapped to Pfam PF00148

6. Protein automated matches [190199] (2 species)
   not a true protein

7. Species Clostridium pasteurianum [TaxId:1262449] [269442] (1 PDB entry)

8. Domain d4wesa_: 4wes A: [269443]
   Other proteins in same PDB: d4wesb_, d4wesd_
   automated match to d1mioa_
   complexed with clf, fe2, hca, ics, mpd

Details for d4wesa_

PDB Entry: 4wes, 1.08 Å

PDB Description: nitrogenase molybdenum-iron protein from clostridium pasteurianum at 1.08 a resolution

PDB Compounds: (A:) nitrogenase molybdenum-iron protein alpha chain

SCOPe Domain Sequences for d4wesa_:

Sequence; same for both SEQRES and ATOM records:

>d4wesa_ c.92.2.3 (A:) automated matches {Clostridium pasteurianum [TaxId: 1262449]}
enlkdeilekyipktkktrsghivikteetpnpeivantrtvpgiitargcayagckgvv
mgpikdmvhithgpigcsfytwggrrfkskpengtglnfneyvfstdmqesdivfggvnk
lkdaiheayemfhpaaigvyatcpvgligddilavaataskeigipvhafscegykgvsq
saghhianntvmtdiigkgnkeqkkysinvlgeyniggdawemdrvlekigyhvnatltg
datyekvqnadkadlnlvqchrsinyiaemmetkygipwikcnfigvdgivetlrdmakc
fddpeltkrteeviaeeiaaiqddldyfkeklqgktaclyvggsrshtymnmlksfgvds
lvagfefahrddyegreviptikidadsknipeitvtpdeqkyrvvipedkveelkkagv
plssyggmmkemhdgtiliddmnhhdmevvleklkpdmffagikekfviqkggvlskqlh
sydyngpyagfrgvvnfghelvngiytpawkmitppwkk

Timeline for d4wesa_:

• d4wesa_ is new in SCOPe 2.05-stable
  
• d4wesa_ appears in SCOPe 2.06
  
• d4wesa_ appears in the current release, SCOPe 2.08