Lineage for d4wesa_ (4wes A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912237Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2912348Superfamily c.92.2: 'Helical backbone' metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2912424Family c.92.2.3: Nitrogenase iron-molybdenum protein [53816] (3 proteins)
    contains three domains of this fold; "Helical backbone" holds domains 2 and 3
    both chains are homologous; the inter-chain arrangement of domains 1 is similar to the intra-chain arrangement of domains 2 and 3
    automatically mapped to Pfam PF00148
  6. 2912613Protein automated matches [190199] (4 species)
    not a true protein
  7. 2912667Species Clostridium pasteurianum [TaxId:1262449] [269442] (1 PDB entry)
  8. 2912668Domain d4wesa_: 4wes A: [269443]
    Other proteins in same PDB: d4wesb_, d4wesd_
    automated match to d1mioa_
    complexed with clf, fe2, hca, ics, mpd

Details for d4wesa_

PDB Entry: 4wes (more details), 1.08 Å

PDB Description: nitrogenase molybdenum-iron protein from clostridium pasteurianum at 1.08 a resolution
PDB Compounds: (A:) nitrogenase molybdenum-iron protein alpha chain

SCOPe Domain Sequences for d4wesa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wesa_ c.92.2.3 (A:) automated matches {Clostridium pasteurianum [TaxId: 1262449]}
enlkdeilekyipktkktrsghivikteetpnpeivantrtvpgiitargcayagckgvv
mgpikdmvhithgpigcsfytwggrrfkskpengtglnfneyvfstdmqesdivfggvnk
lkdaiheayemfhpaaigvyatcpvgligddilavaataskeigipvhafscegykgvsq
saghhianntvmtdiigkgnkeqkkysinvlgeyniggdawemdrvlekigyhvnatltg
datyekvqnadkadlnlvqchrsinyiaemmetkygipwikcnfigvdgivetlrdmakc
fddpeltkrteeviaeeiaaiqddldyfkeklqgktaclyvggsrshtymnmlksfgvds
lvagfefahrddyegreviptikidadsknipeitvtpdeqkyrvvipedkveelkkagv
plssyggmmkemhdgtiliddmnhhdmevvleklkpdmffagikekfviqkggvlskqlh
sydyngpyagfrgvvnfghelvngiytpawkmitppwkk

SCOPe Domain Coordinates for d4wesa_:

Click to download the PDB-style file with coordinates for d4wesa_.
(The format of our PDB-style files is described here.)

Timeline for d4wesa_: