PDB entry 4wes

View 4wes on RCSB PDB site
Description: Nitrogenase molybdenum-iron protein from Clostridium pasteurianum at 1.08 A resolution
Class: oxidoreductase
Keywords: nitrogen fixation, OXIDOREDUCTASE
Deposited on 2014-09-10, released 2015-02-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-02-25, with a file datestamp of 2015-02-20.
Experiment type: XRAY
Resolution: 1.08 Å
R-factor: 0.111
AEROSPACI score: 0.88 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrogenase molybdenum-iron protein alpha chain
    Species: Clostridium pasteurianum [TaxId:1262449]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4wesa_
  • Chain 'B':
    Compound: nitrogenase molybdenum-iron protein beta chain
    Species: Clostridium pasteurianum [TaxId:1262449]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4wesb_
  • Chain 'C':
    Compound: nitrogenase molybdenum-iron protein alpha chain
    Species: Clostridium pasteurianum [TaxId:1262449]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4wesc_
  • Chain 'D':
    Compound: nitrogenase molybdenum-iron protein beta chain
    Species: Clostridium pasteurianum [TaxId:1262449]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4wesd_
  • Heterogens: HCA, ICS, MPD, CLF, FE2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4wesA (A:)
    msenlkdeilekyipktkktrsghivikteetpnpeivantrtvpgiitargcayagckg
    vvmgpikdmvhithgpigcsfytwggrrfkskpengtglnfneyvfstdmqesdivfggv
    nklkdaiheayemfhpaaigvyatcpvgligddilavaataskeigipvhafscegykgv
    sqsaghhianntvmtdiigkgnkeqkkysinvlgeyniggdawemdrvlekigyhvnatl
    tgdatyekvqnadkadlnlvqchrsinyiaemmetkygipwikcnfigvdgivetlrdma
    kcfddpeltkrteeviaeeiaaiqddldyfkeklqgktaclyvggsrshtymnmlksfgv
    dslvagfefahrddyegreviptikidadsknipeitvtpdeqkyrvvipedkveelkka
    gvplssyggmmkemhdgtiliddmnhhdmevvleklkpdmffagikekfviqkggvlskq
    lhsydyngpyagfrgvvnfghelvngiytpawkmitppwkkasseskvvvggea
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wesA (A:)
    enlkdeilekyipktkktrsghivikteetpnpeivantrtvpgiitargcayagckgvv
    mgpikdmvhithgpigcsfytwggrrfkskpengtglnfneyvfstdmqesdivfggvnk
    lkdaiheayemfhpaaigvyatcpvgligddilavaataskeigipvhafscegykgvsq
    saghhianntvmtdiigkgnkeqkkysinvlgeyniggdawemdrvlekigyhvnatltg
    datyekvqnadkadlnlvqchrsinyiaemmetkygipwikcnfigvdgivetlrdmakc
    fddpeltkrteeviaeeiaaiqddldyfkeklqgktaclyvggsrshtymnmlksfgvds
    lvagfefahrddyegreviptikidadsknipeitvtpdeqkyrvvipedkveelkkagv
    plssyggmmkemhdgtiliddmnhhdmevvleklkpdmffagikekfviqkggvlskqlh
    sydyngpyagfrgvvnfghelvngiytpawkmitppwkk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4wesB (B:)
    mldatpkeiverkalrinpaktcqpvgamyaalgihnclphshgsqgccsyhrtvlsrhf
    kepamastssftegasvfgggsniktavknifslynpdiiavhttclsetlgddlptyis
    qmedagsipegklvihtntpsyvgshvtgfanmvqgivnylsentgakngkinvipgfvg
    padmreikrlfeamdipyimfpdtsgvldgpttgeykmypeggtkiedlkdtgnsdltls
    lgsyasdlgaktlekkckvpfktlrtpigvsatdefimalseatgkevpasieeergqli
    dlmidaqqylqgkkvallgdpdeiialskfiielgaipkyvvtgtpgmkfqkeidamlae
    agiegskvkvegdffdvhqwiknegvdllisntygkfiareenipfvrfgfpimdryghy
    ynpkvgykgairlveeitnvildkierecteedfevvr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4wesC (C:)
    msenlkdeilekyipktkktrsghivikteetpnpeivantrtvpgiitargcayagckg
    vvmgpikdmvhithgpigcsfytwggrrfkskpengtglnfneyvfstdmqesdivfggv
    nklkdaiheayemfhpaaigvyatcpvgligddilavaataskeigipvhafscegykgv
    sqsaghhianntvmtdiigkgnkeqkkysinvlgeyniggdawemdrvlekigyhvnatl
    tgdatyekvqnadkadlnlvqchrsinyiaemmetkygipwikcnfigvdgivetlrdma
    kcfddpeltkrteeviaeeiaaiqddldyfkeklqgktaclyvggsrshtymnmlksfgv
    dslvagfefahrddyegreviptikidadsknipeitvtpdeqkyrvvipedkveelkka
    gvplssyggmmkemhdgtiliddmnhhdmevvleklkpdmffagikekfviqkggvlskq
    lhsydyngpyagfrgvvnfghelvngiytpawkmitppwkkasseskvvvggea
    

    Sequence, based on observed residues (ATOM records): (download)
    >4wesC (C:)
    enlkdeilekyipktkktrsghivikteetpnpeivantrtvpgiitargcayagckgvv
    mgpikdmvhithgpigcsfytwggrrfkskpengtglnfneyvfstdmqesdivfggvnk
    lkdaiheayemfhpaaigvyatcpvgligddilavaataskeigipvhafscegykgvsq
    saghhianntvmtdiigkgnkeqkkysinvlgeyniggdawemdrvlekigyhvnatltg
    datyekvqnadkadlnlvqchrsinyiaemmetkygipwikcnfigvdgivetlrdmakc
    fddpeltkrteeviaeeiaaiqddldyfkeklqgktaclyvggsrshtymnmlksfgvds
    lvagfefahrddyegreviptikidadsknipeitvtpdeqkyrvvipedkveelkkagv
    plssyggmmkemhdgtiliddmnhhdmevvleklkpdmffagikekfviqkggvlskqlh
    sydyngpyagfrgvvnfghelvngiytpawkmitppwk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4wesD (D:)
    mldatpkeiverkalrinpaktcqpvgamyaalgihnclphshgsqgccsyhrtvlsrhf
    kepamastssftegasvfgggsniktavknifslynpdiiavhttclsetlgddlptyis
    qmedagsipegklvihtntpsyvgshvtgfanmvqgivnylsentgakngkinvipgfvg
    padmreikrlfeamdipyimfpdtsgvldgpttgeykmypeggtkiedlkdtgnsdltls
    lgsyasdlgaktlekkckvpfktlrtpigvsatdefimalseatgkevpasieeergqli
    dlmidaqqylqgkkvallgdpdeiialskfiielgaipkyvvtgtpgmkfqkeidamlae
    agiegskvkvegdffdvhqwiknegvdllisntygkfiareenipfvrfgfpimdryghy
    ynpkvgykgairlveeitnvildkierecteedfevvr