Class g: Small proteins [56992] (98 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) |
Family g.3.7.2: Short-chain scorpion toxins [57116] (35 proteins) |
Protein automated matches [197331] (11 species) not a true protein |
Species Mesobuthus martensii [TaxId:34649] [255319] (5 PDB entries) |
Domain d2mlda_: 2mld A: [269248] automated match to d1bkta_ |
PDB Entry: 2mld (more details)
SCOPe Domain Sequences for d2mlda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mlda_ g.3.7.2 (A:) automated matches {Mesobuthus martensii [TaxId: 34649]} vginvdckhsgqclkpckkagmrfgkcingkcdctpk
Timeline for d2mlda_: