Lineage for d2mlda_ (2mld A:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1960255Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1960727Superfamily g.3.7: Scorpion toxin-like [57095] (5 families) (S)
  5. 1960843Family g.3.7.2: Short-chain scorpion toxins [57116] (35 proteins)
  6. 1960968Protein automated matches [197331] (4 species)
    not a true protein
  7. 1960973Species Mesobuthus martensii [TaxId:34649] [255319] (3 PDB entries)
  8. 1960975Domain d2mlda_: 2mld A: [269248]
    automated match to d1bkta_

Details for d2mlda_

PDB Entry: 2mld (more details)

PDB Description: Solution structure of BmKTX-D19K/K6D
PDB Compounds: (A:) Potassium channel toxin alpha-KTx 3.6

SCOPe Domain Sequences for d2mlda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mlda_ g.3.7.2 (A:) automated matches {Mesobuthus martensii [TaxId: 34649]}
vginvdckhsgqclkpckkagmrfgkcingkcdctpk

SCOPe Domain Coordinates for d2mlda_:

Click to download the PDB-style file with coordinates for d2mlda_.
(The format of our PDB-style files is described here.)

Timeline for d2mlda_: