SCOPe 2.08: Domain d1g8ja1: 1g8j A:683-825

Lineage for d1g8ja1 (1g8j A:683-825)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
   barrel, closed; n=6, S=10; complex topology with crossover (psi) loops

4. Superfamily b.52.2: ADC-like [50692] (4 families)

5. Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (10 proteins)
   molybdopterine enzyme

6. Protein Arsenite oxidase large subunit [50704] (1 species)

7. Species Alcaligenes faecalis [TaxId:511] [50705] (2 PDB entries)

8. Domain d1g8ja1: 1g8j A:683-825 [26924]
   Other proteins in same PDB: d1g8ja2, d1g8jb_, d1g8jc2, d1g8jd_
   complexed with 4mo, f3s, fes, mgd, o

Details for d1g8ja1

PDB Entry: 1g8j, 2.03 Å

PDB Description: crystal structure analysis of arsenite oxidase from alcaligenes faecalis

PDB Compounds: (A:) arsenite oxidase

SCOPe Domain Sequences for d1g8ja1:

Sequence; same for both SEQRES and ATOM records:

>d1g8ja1 b.52.2.2 (A:683-825) Arsenite oxidase large subunit {Alcaligenes faecalis [TaxId: 511]}
lpatvqqqkdkyrfwlnngrnnevwqtayhdqynslmqerypmayiemnpddckqldvtg
gdivevyndfgstfamvypvaeikrgqtfmlfgyvngiqgdvttdwtdrdiipyykgtwg
dirkvgsmsefkrtvsfksrrfg

Timeline for d1g8ja1:

• d1g8ja1 first appeared (with stable ids) in SCOP 1.55
  
• d1g8ja1 appears in SCOPe 2.07