![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.52: Double psi beta-barrel [50684] (2 superfamilies) barrel, closed; n=6, S=10; complex topology with crossover (psi) loops |
![]() | Superfamily b.52.2: ADC-like [50692] (4 families) ![]() |
![]() | Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (10 proteins) molybdopterine enzyme |
![]() | Protein Arsenite oxidase large subunit [50704] (1 species) |
![]() | Species Alcaligenes faecalis [TaxId:511] [50705] (2 PDB entries) |
![]() | Domain d1g8ja1: 1g8j A:683-825 [26924] Other proteins in same PDB: d1g8ja2, d1g8jb_, d1g8jc2, d1g8jd_ complexed with 4mo, f3s, fes, mgd, o |
PDB Entry: 1g8j (more details), 2.03 Å
SCOPe Domain Sequences for d1g8ja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g8ja1 b.52.2.2 (A:683-825) Arsenite oxidase large subunit {Alcaligenes faecalis [TaxId: 511]} lpatvqqqkdkyrfwlnngrnnevwqtayhdqynslmqerypmayiemnpddckqldvtg gdivevyndfgstfamvypvaeikrgqtfmlfgyvngiqgdvttdwtdrdiipyykgtwg dirkvgsmsefkrtvsfksrrfg
Timeline for d1g8ja1:
![]() Domains from other chains: (mouse over for more information) d1g8jb_, d1g8jc1, d1g8jc2, d1g8jd_ |