Lineage for d1g8jd_ (1g8j D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782333Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 2782334Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 2782335Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins)
  6. 2782336Protein Arsenite oxidase Rieske subunit [50029] (1 species)
  7. 2782337Species Alcaligenes faecalis [TaxId:511] [50030] (2 PDB entries)
  8. 2782339Domain d1g8jd_: 1g8j D: [24440]
    Other proteins in same PDB: d1g8ja1, d1g8ja2, d1g8jc1, d1g8jc2
    complexed with 4mo, f3s, fes, mgd, o

Details for d1g8jd_

PDB Entry: 1g8j (more details), 2.03 Å

PDB Description: crystal structure analysis of arsenite oxidase from alcaligenes faecalis
PDB Compounds: (D:) arsenite oxidase

SCOPe Domain Sequences for d1g8jd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g8jd_ b.33.1.1 (D:) Arsenite oxidase Rieske subunit {Alcaligenes faecalis [TaxId: 511]}
aypatavsvaknlaanepssftypdtsspcvavklgapvpggvgpdddivaysvlcthmg
cptsydsssktfscpchftefdaekagqmicgeatadlprvllrydaasdaltavgvdgl
iygrqanvi

SCOPe Domain Coordinates for d1g8jd_:

Click to download the PDB-style file with coordinates for d1g8jd_.
(The format of our PDB-style files is described here.)

Timeline for d1g8jd_: