Class b: All beta proteins [48724] (180 folds) |
Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
Superfamily b.33.1: ISP domain [50022] (4 families) |
Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins) |
Protein Arsenite oxidase Rieske subunit [50029] (1 species) |
Species Alcaligenes faecalis [TaxId:511] [50030] (2 PDB entries) |
Domain d1g8jd_: 1g8j D: [24440] Other proteins in same PDB: d1g8ja1, d1g8ja2, d1g8jc1, d1g8jc2 complexed with 4mo, f3s, fes, mgd, o |
PDB Entry: 1g8j (more details), 2.03 Å
SCOPe Domain Sequences for d1g8jd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g8jd_ b.33.1.1 (D:) Arsenite oxidase Rieske subunit {Alcaligenes faecalis [TaxId: 511]} aypatavsvaknlaanepssftypdtsspcvavklgapvpggvgpdddivaysvlcthmg cptsydsssktfscpchftefdaekagqmicgeatadlprvllrydaasdaltavgvdgl iygrqanvi
Timeline for d1g8jd_: