Lineage for d1g8ja2 (1g8j A:6-682)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140533Fold c.81: Formate dehydrogenase/DMSO reductase, domains 1-3 [53705] (1 superfamily)
    contains of two similar intertwined domains related by pseudo dyad; duplication
    core: 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451
  4. 2140534Superfamily c.81.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53706] (1 family) (S)
    molybdopterine enzyme
  5. 2140535Family c.81.1.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53707] (11 protein domains)
    domain 1 (residues 1-55) binds Fe4S4 cluster in FDH but not DMSO reductase
  6. 2140536Protein Arsenite oxidase large subunit [53715] (1 species)
  7. 2140537Species Alcaligenes faecalis [TaxId:511] [53716] (2 PDB entries)
  8. 2140542Domain d1g8ja2: 1g8j A:6-682 [35332]
    Other proteins in same PDB: d1g8ja1, d1g8jb_, d1g8jc1, d1g8jd_
    complexed with 4mo, f3s, fes, mgd, o

Details for d1g8ja2

PDB Entry: 1g8j (more details), 2.03 Å

PDB Description: crystal structure analysis of arsenite oxidase from alcaligenes faecalis
PDB Compounds: (A:) arsenite oxidase

SCOPe Domain Sequences for d1g8ja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g8ja2 c.81.1.1 (A:6-682) Arsenite oxidase large subunit {Alcaligenes faecalis [TaxId: 511]}
ritlppanaqrtnmtchfcivgcgyhvykwpeleeggrapeqnalgldfrkqlpplastl
tpamtnvvtehdgarydimvvpdkacvvnsglsstrggkmasymytptgdgkerlsaprl
yaadewvdttwdhamalyaglikktldsdgpqgvffscfdhggagggfentwgtgklmfs
aiqtpmvrihnrpaynsechatremgigelnnayedaqladviwsignnpyesqtnyfln
hwlpnlqgattskkkerfpnenfpqariifvdpretpsvaiarhvagndrvlhlaiepgt
dtalfnglftyvveqgwidkpfieahtkgfddavktnrlsldecsnitgvpvdmlkraae
wsykpkasgqaprtmhayekgiiwgndnyviqsalldlviathnvgrrgtgcvrmgghqe
gytrppypgdkkiyidqelikgkgrimtwwgcnnfqtsnnaqalreailqrsaivkqamq
kargatteemvdviyeatqngglfvtsinlyptklaeaahlmlpaahpgemnltsmnger
rirlsekfmdppgtamadcliaarianalrdmyqkdgkaemaaqfegfdwkteedafndg
frragqpgapaidsqggstghlvtydrlrksgnngvqlpvvswdeskglvgtemlytegk
fdtddgkahfkpapwng

SCOPe Domain Coordinates for d1g8ja2:

Click to download the PDB-style file with coordinates for d1g8ja2.
(The format of our PDB-style files is described here.)

Timeline for d1g8ja2: