Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins) contains a catalytic Cys-His-Glu triad |
Protein automated matches [190743] (4 species) not a true protein |
Species Geobacillus kaustophilus [TaxId:235909] [269093] (1 PDB entry) |
Domain d4wxyl_: 4wxy L: [269110] Other proteins in same PDB: d4wxya_, d4wxyc_, d4wxye_, d4wxyg_, d4wxyi_, d4wxyk_ automated match to d1q7ra_ mutant |
PDB Entry: 4wxy (more details), 2.7 Å
SCOPe Domain Sequences for d4wxyl_:
Sequence, based on SEQRES records: (download)
>d4wxyl_ c.23.16.1 (L:) automated matches {Geobacillus kaustophilus [TaxId: 235909]} mkigvlglqgavrehvraieacgaeavivkkseqlegldglvlpggesttmrrlidrygl meplkqfaaagkpmfgtcaglillakrivgydephlglmditvernsfgrqresfeaels ikgvgdgfvgvfiraphiveagdgvdvlatyndrivaarqgqflgcsfnpeltddhrlmq yflnmvkeakma
>d4wxyl_ c.23.16.1 (L:) automated matches {Geobacillus kaustophilus [TaxId: 235909]} mkigvlglqgavrehvraieacgaeavivkkseqlegldglvlpggesttmrrlidrygl meplkqfaaagkpmfgtcaglillakrivgydephlglmditvernsfgrqresfeaels ikgvdgfvgvfiraphiveagdgvdvlatyndrivaarqgqflgcsfnpeltddhrlmqy flnmvkeakma
Timeline for d4wxyl_: