Lineage for d4wxyj_ (4wxy J:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2467009Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2467010Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins)
    contains a catalytic Cys-His-Glu triad
  6. 2467167Protein automated matches [190743] (4 species)
    not a true protein
  7. 2467181Species Geobacillus kaustophilus [TaxId:235909] [269093] (1 PDB entry)
  8. 2467186Domain d4wxyj_: 4wxy J: [269099]
    Other proteins in same PDB: d4wxya_, d4wxyc_, d4wxye_, d4wxyg_, d4wxyi_, d4wxyk_
    automated match to d1q7ra_
    mutant

Details for d4wxyj_

PDB Entry: 4wxy (more details), 2.7 Å

PDB Description: plps (inactive glutaminase mutant) co-crystallized with glutamine and r5p.
PDB Compounds: (J:) Glutamine amidotransferase subunit pdxT

SCOPe Domain Sequences for d4wxyj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wxyj_ c.23.16.1 (J:) automated matches {Geobacillus kaustophilus [TaxId: 235909]}
mkigvlglqgavrehvraieacgaeavivkkseqlegldglvlpggesttmrrlidrygl
meplkqfaaagkpmfgtcaglillakrivgydephlglmditvernsfgrqresfeaels
ikgvgdgfvgvfiraphiveagdgvdvlatyndrivaarqgqflgcsfnpeltddhrlmq
yflnmvkea

SCOPe Domain Coordinates for d4wxyj_:

Click to download the PDB-style file with coordinates for d4wxyj_.
(The format of our PDB-style files is described here.)

Timeline for d4wxyj_: